Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Human (HEK293, His)

IL-13 Protein, Human (HEK293, His) is a cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human (HEK293, His) is a recombinant human interleukin-13 (rhIL-13) expressed in HEK 293 cells with a His tag.

Product Specifications

Product Name Alternative

IL-13 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-human-hek293-his.html

Purity

98.0

Smiles

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Molecular Formula

3596 (Gene_ID) P35225/AAH96139 (G35-N146) (Accession)

Molecular Weight

Approximately 13-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Cannon-Carlson S, et al. Expression, purification, and characterization of recombinant human interleukin-13 from NS-O cells. Protein Expr Purif. 1998 Mar;12 (2) :239-48.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL
BNC680031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL
BNC470437-500 1x 500 µL

CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL
BNC680460-100 1x 100 µL

CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 / MS4A1 (B-Cell Marker) (rIGEL/773), CF405S conjugate, 0.1mg/mL
BNC041829-100 1x 100 µL

CD20 / MS4A1 (B-Cell Marker) (rIGEL/773), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (1415-1), CF740 conjugate, 0.1mg/mL
BNC740580-100 1x 100 µL

Histone H1 (1415-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C-Myc (MYC275), CF740 conjugate, 0.1mg/mL
BNC740275-500 1x 500 µL

C-Myc (MYC275), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details