Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-13, Human (HEK293, His)

IL-13 Protein, Human (HEK293, His) is a cytokine which affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. IL-13 Protein, Human (HEK293, His) is a recombinant human interleukin-13 (rhIL-13) expressed in HEK 293 cells with a His tag.

Product Specifications

Product Name Alternative

IL-13 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-13-protein-human-hek293-his.html

Purity

98.0

Smiles

GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Molecular Formula

3596 (Gene_ID) P35225/AAH96139 (G35-N146) (Accession)

Molecular Weight

Approximately 13-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Cannon-Carlson S, et al. Expression, purification, and characterization of recombinant human interleukin-13 from NS-O cells. Protein Expr Purif. 1998 Mar;12 (2) :239-48.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Placental Protein 13 (PP13) Monoclonal antibody
FY-AB36835-01 1 mL

Anti-Placental Protein 13 (PP13) Monoclonal antibody

Sign In for Pricing
View Details
Anti-Placental Protein 13 (PP13) Monoclonal antibody
FY-AB36835-02 100 µL

Anti-Placental Protein 13 (PP13) Monoclonal antibody

Sign In for Pricing
View Details
Anti-Placental Protein 13 (PP13) Monoclonal antibody
FY-AB36835-03 200 µL

Anti-Placental Protein 13 (PP13) Monoclonal antibody

Sign In for Pricing
View Details
PD-1/PDCD1, Recombinant, Human, His-Tag, Active discontinued
046943 100 µg

PD-1/PDCD1, Recombinant, Human, His-Tag, Active discontinued

Sign In for Pricing
View Details
Recombinant Gorilla gorilla gorilla Beta-defensin 105A (DEFB105A)
MBS1059942-01 0.05 mg (E-Coli)

Recombinant Gorilla gorilla gorilla Beta-defensin 105A (DEFB105A)

Sign In for Pricing
View Details
Recombinant Gorilla gorilla gorilla Beta-defensin 105A (DEFB105A)
MBS1059942-02 0.2 mg (E-Coli)

Recombinant Gorilla gorilla gorilla Beta-defensin 105A (DEFB105A)

Sign In for Pricing
View Details