Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eotaxin-3/CCL26, Human

Eotaxin-3/CCL26 Protein, Human is a CC chemokine that binds to chemokine receptors CCR3 or CX3CR1 and is a chemotactic agent for eosinophils and basophils that mediates inflammatory responses. Eotaxin-3/CCL26 Protein, Human is a recombinant human Eotaxin-3/CCL26 (T24-L94) protein expressed by E. coli[1].

Product Specifications

Product Name Alternative

Eotaxin-3/CCL26 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/eotaxin-3-ccl26-protein-human.html

Purity

95.0

Smiles

TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL

Molecular Formula

10344 (Gene_ID) Q9Y258 (T24-L94) (Accession)

Molecular Weight

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Banwell ME, et al. Regulation of human eotaxin-3/CCL26 expression: modulation by cytokines and glucocorticoids. Cytokine. 2002 Mar 21;17 (6) :317-23.|[2]Larose MC, et al. Correlation between CCL26 production by human bronchial epithelial cells and airway eosinophils: Involvement in patients with severe eosinophilic asthma. J Allergy Clin Immunol. 2015 Oct;136 (4) :904-13.|[3]Marie-Chantal Larose, et al. Correlation between CCL26 production by human bronchial epithelial cells and airway eosinophils: Involvement in patients with severe eosinophilic asthma. J Allergy Clin Immunol. 2015 Oct;136 (4) :904-13.|[4]Véronique Provost, et al. CCL26/eotaxin-3 is more effective to induce the migration of eosinophils of asthmatics than CCL11/eotaxin-1 and CCL24/eotaxin-2. J Leukoc Biol. 2013 Aug;94 (2) :213-22.|[5]Takashi Nakayama, et al. Eotaxin-3/CC chemokine ligand 26 is a functional ligand for CX3CR1. J Immunol. 2010 Dec 1;185 (11) :6472-9.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RNF113B Antibody
GWB-EAF48A 0.1 mg

RNF113B Antibody

Ask
View Details
DGKK (Diacylglycerol Kinase, kappa) (APC)
MBS6170297-01 0.1 mL

DGKK (Diacylglycerol Kinase, kappa) (APC)

Ask
View Details
DGKK (Diacylglycerol Kinase, kappa) (APC)
MBS6170297-02 5x 0.1 mL

DGKK (Diacylglycerol Kinase, kappa) (APC)

Ask
View Details
Tubulysin C
MF-0031798-01 100 mg

Tubulysin C

Ask
View Details
Tubulysin C
MF-0031798-02 500 mg

Tubulysin C

Ask
View Details
SYCE1 (Synaptonemal Complex Central Element Protein 1, C10orf94, RP11-108K14.6, bA108K14.6) (HRP)
252304-HRP 100 µL

SYCE1 (Synaptonemal Complex Central Element Protein 1, C10orf94, RP11-108K14.6, bA108K14.6) (HRP)

Ask
View Details