Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC-1/CLEC1A, Human (HEK293, Fc)

CLEC-1/CLEC1A proteins belong to the CTL/CTLD superfamily and are known for their diverse functions in cell adhesion, signaling, glycoprotein turnover, inflammation, and immune responses. It is involved in potentially regulating dendritic cell function. CLEC-1/CLEC1A Protein, Human (HEK293, Fc) is the recombinant human-derived CLEC-1/CLEC1A protein, expressed by HEK293 , with N-hFc labeled tag.

Product Specifications

Product Name Alternative

CLEC-1/CLEC1A Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clec-1-clec1a-protein-human-hek293-fc.html

Purity

95.62

Smiles

QLSNTGQDTISQMEERLGNTSQELQSLQVQNIKLAGSLQHVAEKLCRELYNKAGAHRCSPCTEQWKWHGDNCYQFYKDSKSWEDCKYFCLSENSTMLKINKQEDLEFAASQSYSEFFYSYWTGLLRPDSGKAWLWMDGTPFTSELFHIIIDVTSPRSRDCVAILNGMIFSKDCKELKRCVCERRAGMVKPESLHVPPETLGEGD

Molecular Formula

51267 (Gene_ID) Q8NC01/NP_057595.2 (Q77-D280) (Accession)

Molecular Weight

Approximately 56.48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPSAB1 mouse monoclonal antibody, clone G3, Supernatant
AM10146SU-N 1 mL

TPSAB1 mouse monoclonal antibody, clone G3, Supernatant

Sign In for Pricing
View Details
Fosbretabulin disodium (CA4P) 10mg
A13081-10 10 mg

Fosbretabulin disodium (CA4P) 10mg

Sign In for Pricing
View Details
Recombinant Bartonella henselae Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] (glmS), partial
MBS1472590 Inquire

Recombinant Bartonella henselae Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] (glmS), partial

Sign In for Pricing
View Details
PQLC3 sgRNA CRISPR Lentivector (Human) (Target 2)
K1711603 1.0 µg DNA

PQLC3 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Uncoupling Protein 3 (UCP3) (Not for Export EU)
U1622-23 100 µL

Uncoupling Protein 3 (UCP3) (Not for Export EU)

Sign In for Pricing
View Details
Pallidin (BLOC1S6) (NM_012388) Human Recombinant Protein
TP301514 20 µg

Pallidin (BLOC1S6) (NM_012388) Human Recombinant Protein

Sign In for Pricing
View Details