Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2F, Human (His, Solution)

The UBE2F protein accepts NEDD8 from the UBA3-NAE1 E1 complex and covalently links it to various target proteins in the ubiquitin-like NEDD8 conjugation pathway. The RBX2-UBE2F complex specifically interacts with the E3 ubiquitin ligase RBX2, but not RBX1, for the neddylation of specific targets, especially CUL5. UBE2F Protein, Human (His, Solution) is the recombinant human-derived UBE2F, expressed by E. coli, with N-6*His labeled tag.

Product Specifications

Product Name Alternative

UBE2F Protein, Human (His, Solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ube2f-protein-human-his-solution.html

Purity

98.0

Smiles

MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR

Molecular Formula

140739 (Gene_ID) Q969M7-1 (M1-R185) (Accession)

Molecular Weight

Approximately 23 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

8Br-GTP
M-NU-118S 50 μL

8Br-GTP

Sign In for Pricing
View Details
Lentiviral human GSK3A sgRNA gene knockout kit - Lentiviral human GSK3A sgRNA gene knockout kit (plasmid)
GTR15375749 1 Vial

Lentiviral human GSK3A sgRNA gene knockout kit - Lentiviral human GSK3A sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Anti-Lin28/LIN28A Antibody Picoband®, APC Conjugate
A01966-2-APC 100 µg/Vial

Anti-Lin28/LIN28A Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
HSP10 Colorimetric Cell-Based ELISA Kit
EKC1286 1 Kit, containing one 96 Well Plate and all necessary reagents

HSP10 Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
Human Myosin-Ih (MYO1H) ELISA Kit
KTE61418-01 48 Tests

Human Myosin-Ih (MYO1H) ELISA Kit

Sign In for Pricing
View Details
Human Myosin-Ih (MYO1H) ELISA Kit
KTE61418-02 96 Tests

Human Myosin-Ih (MYO1H) ELISA Kit

Sign In for Pricing
View Details