B7-H2/ICOSLG, Human (HEK293, His)
B7-H2/ICOSLG Protein, Human (HEK293, His) is a polypeptide chain containing the C-termimal His tag produced in HEK293 cells. ICOSLG is a number of the B7 family of co-stimulatory molecules.
Product Specifications
Product Name Alternative
B7-H2/ICOSLG Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/b7-h2-icoslg-protein-human-hek293-his.html
Purity
95.00
Smiles
DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSHHHHHHHHHH
Molecular Formula
23308 (Gene_ID) O75144-1 (D19-S258) (Accession)
Molecular Weight
45-55 kDa
References & Citations
[1]Wang B, et al. Effects of ICOSLG expressed in mouse hematological neoplasm cell lines in the GVL reaction. Bone Marrow Transplant. 2013 Jan;48 (1) :124-8.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
JOT-EK0176Mo 96 wells
Mouse Heat shock factor protein 1,Hsf1 ELISA KIT
Sign In for Pricing
View Details 126954-ML550 100 µL
FOXL1 (Forkhead Box Protein L1, FKHL11, Forkhead-Related Transcription Factor 7, Forkhead-related Protein FKHL11, FREAC7, FREAC-7) (MaxLight 550)
Sign In for Pricing
View Details 
GTR15207039 1 Vial
Lentiviral mouse Hcst shRNA (UAS) - Lentiviral mouse Hcst shRNA (UAS, iRFP) (100)
Sign In for Pricing
View Details 
K1293502 1.0 µg DNA
METTL3 sgRNA CRISPR Lentivector (Human) (Target 1)
Sign In for Pricing
View Details MBS281392-01 48 Tests
Human PRKR-interacting protein 1 (PRKRIP1) ELISA Kit
Sign In for Pricing
View Details