Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H2/ICOSLG, Human (HEK293, His)

B7-H2/ICOSLG Protein, Human (HEK293, His) is a polypeptide chain containing the C-termimal His tag produced in HEK293 cells. ICOSLG is a number of the B7 family of co-stimulatory molecules.

Product Specifications

Product Name Alternative

B7-H2/ICOSLG Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h2-icoslg-protein-human-hek293-his.html

Purity

95.00

Smiles

DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSHHHHHHHHHH

Molecular Formula

23308 (Gene_ID) O75144-1 (D19-S258) (Accession)

Molecular Weight

45-55 kDa

References & Citations

[1]Wang B, et al. Effects of ICOSLG expressed in mouse hematological neoplasm cell lines in the GVL reaction. Bone Marrow Transplant. 2013 Jan;48 (1) :124-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC37A1 Protein Vector (Mouse) (pPB-C-His)
PV230702 500 ng

SLC37A1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
TXNIP AAV Vector (Rat) (CMV)
48879106 1 µg

TXNIP AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Ctag2 (NM_027302) Mouse Tagged ORF Clone
MG219735 10 µg

Ctag2 (NM_027302) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
2B-(SP)(TFA)
MBS5817717 Inquire

2B-(SP)(TFA)

Sign In for Pricing
View Details
Phosphatidylcholine-Sterol Acyltransferase (LCAT) Antibody
abx431380 200 µL

Phosphatidylcholine-Sterol Acyltransferase (LCAT) Antibody

Sign In for Pricing
View Details
COLGALT1 Knockout Hela Polyclonal Cells
ARG8671 1 Million

COLGALT1 Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details