Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H2/ICOSLG, Human (HEK293, His)

B7-H2/ICOSLG Protein, Human (HEK293, His) is a polypeptide chain containing the C-termimal His tag produced in HEK293 cells. ICOSLG is a number of the B7 family of co-stimulatory molecules.

Product Specifications

Product Name Alternative

B7-H2/ICOSLG Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h2-icoslg-protein-human-hek293-his.html

Purity

95.00

Smiles

DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSHHHHHHHHHH

Molecular Formula

23308 (Gene_ID) O75144-1 (D19-S258) (Accession)

Molecular Weight

45-55 kDa

References & Citations

[1]Wang B, et al. Effects of ICOSLG expressed in mouse hematological neoplasm cell lines in the GVL reaction. Bone Marrow Transplant. 2013 Jan;48 (1) :124-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR8U8 Human shRNA Plasmid Kit (Locus ID 504189)
TL310680 1 Kit

OR8U8 Human shRNA Plasmid Kit (Locus ID 504189)

Sign In for Pricing
View Details
Sialosyl-Tn antigen Antibody
GWB-51396C 0.5 mL

Sialosyl-Tn antigen Antibody

Sign In for Pricing
View Details
SH3GL1 Protein Vector (Mouse) (pPB-C-His)
PV228858 500 ng

SH3GL1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
NCL, ID (E443) (NCL, Nucleolin, Protein C23) (PE) discontinued
038833-PE 200 µL

NCL, ID (E443) (NCL, Nucleolin, Protein C23) (PE) discontinued

Sign In for Pricing
View Details
APC_Cy7 Linked Polyclonal Antibody to Complement 1 Inhibitor (C1INH)
MBS2128996-01 0.1 mL

APC_Cy7 Linked Polyclonal Antibody to Complement 1 Inhibitor (C1INH)

Sign In for Pricing
View Details
APC_Cy7 Linked Polyclonal Antibody to Complement 1 Inhibitor (C1INH)
MBS2128996-02 0.2 mL

APC_Cy7 Linked Polyclonal Antibody to Complement 1 Inhibitor (C1INH)

Sign In for Pricing
View Details