Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H2/ICOSLG, Human (HEK293, His)

B7-H2/ICOSLG Protein, Human (HEK293, His) is a polypeptide chain containing the C-termimal His tag produced in HEK293 cells. ICOSLG is a number of the B7 family of co-stimulatory molecules.

Product Specifications

Product Name Alternative

B7-H2/ICOSLG Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h2-icoslg-protein-human-hek293-his.html

Purity

95.00

Smiles

DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSHHHHHHHHHH

Molecular Formula

23308 (Gene_ID) O75144-1 (D19-S258) (Accession)

Molecular Weight

45-55 kDa

References & Citations

[1]Wang B, et al. Effects of ICOSLG expressed in mouse hematological neoplasm cell lines in the GVL reaction. Bone Marrow Transplant. 2013 Jan;48 (1) :124-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Heat shock factor protein 1,Hsf1 ELISA KIT
JOT-EK0176Mo 96 wells

Mouse Heat shock factor protein 1,Hsf1 ELISA KIT

Sign In for Pricing
View Details
FOXL1 (Forkhead Box Protein L1, FKHL11, Forkhead-Related Transcription Factor 7, Forkhead-related Protein FKHL11, FREAC7, FREAC-7) (MaxLight 550)
126954-ML550 100 µL

FOXL1 (Forkhead Box Protein L1, FKHL11, Forkhead-Related Transcription Factor 7, Forkhead-related Protein FKHL11, FREAC7, FREAC-7) (MaxLight 550)

Sign In for Pricing
View Details
Recombinant HEV ORF2 Protein
VAng-Lsx0227-500g 500 µg

Recombinant HEV ORF2 Protein

Sign In for Pricing
View Details
Lentiviral mouse Hcst shRNA (UAS) - Lentiviral mouse Hcst shRNA (UAS, iRFP) (100)
GTR15207039 1 Vial

Lentiviral mouse Hcst shRNA (UAS) - Lentiviral mouse Hcst shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
METTL3 sgRNA CRISPR Lentivector (Human) (Target 1)
K1293502 1.0 µg DNA

METTL3 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Human PRKR-interacting protein 1 (PRKRIP1) ELISA Kit
MBS281392-01 48 Tests

Human PRKR-interacting protein 1 (PRKRIP1) ELISA Kit

Sign In for Pricing
View Details