B7-H2/ICOSLG, Human (HEK293, His)
B7-H2/ICOSLG Protein, Human (HEK293, His) is a polypeptide chain containing the C-termimal His tag produced in HEK293 cells. ICOSLG is a number of the B7 family of co-stimulatory molecules.
Product Specifications
Product Name Alternative
B7-H2/ICOSLG Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/b7-h2-icoslg-protein-human-hek293-his.html
Purity
95.00
Smiles
DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSHHHHHHHHHH
Molecular Formula
23308 (Gene_ID) O75144-1 (D19-S258) (Accession)
Molecular Weight
45-55 kDa
References & Citations
[1]Wang B, et al. Effects of ICOSLG expressed in mouse hematological neoplasm cell lines in the GVL reaction. Bone Marrow Transplant. 2013 Jan;48 (1) :124-8.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
036489-AP 200 µL
HDGFRP3, ID (HDGFRP3, HDGF2, Hepatoma-derived growth factor-related protein 3, Hepatoma-derived growth factor 2) (AP) discontinued
Sign In for Pricing
View Details 
TGOLN2-5701R 50 µg
Recombinant Rat TGOLN2 Protein, His (Fc)-Avi-tagged
Sign In for Pricing
View Details NBP2-73101AF532 0.1 mL
Mouse Monoclonal Nudel Antibody (OTI1G7) [Alexa Fluor 532]
Sign In for Pricing
View Details 