Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H2/ICOSLG, Human (HEK293, His)

B7-H2/ICOSLG Protein, Human (HEK293, His) is a polypeptide chain containing the C-termimal His tag produced in HEK293 cells. ICOSLG is a number of the B7 family of co-stimulatory molecules.

Product Specifications

Product Name Alternative

B7-H2/ICOSLG Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h2-icoslg-protein-human-hek293-his.html

Purity

95.00

Smiles

DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSHHHHHHHHHH

Molecular Formula

23308 (Gene_ID) O75144-1 (D19-S258) (Accession)

Molecular Weight

45-55 kDa

References & Citations

[1]Wang B, et al. Effects of ICOSLG expressed in mouse hematological neoplasm cell lines in the GVL reaction. Bone Marrow Transplant. 2013 Jan;48 (1) :124-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Deer antler velvet Extract
C14952 25 mg

Deer antler velvet Extract

Sign In for Pricing
View Details
C6orf48 Protein Vector (Human) (pPM-C-His)
PV006724 500 ng

C6orf48 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Human SAP18 siRNA
abx932447-01 15 nmol

Human SAP18 siRNA

Sign In for Pricing
View Details
Human SAP18 siRNA
abx932447-02 30 nmol

Human SAP18 siRNA

Sign In for Pricing
View Details
Mouse Monoclonal ZNF343 Antibody (PCRP-ZNF343-4F8)
NBP3-23620-100ug 100 µg

Mouse Monoclonal ZNF343 Antibody (PCRP-ZNF343-4F8)

Sign In for Pricing
View Details
NT5C Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV712896 1.0 µg DNA

NT5C Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details