Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H2/ICOSLG, Human (HEK293, His)

B7-H2/ICOSLG Protein, Human (HEK293, His) is a polypeptide chain containing the C-termimal His tag produced in HEK293 cells. ICOSLG is a number of the B7 family of co-stimulatory molecules.

Product Specifications

Product Name Alternative

B7-H2/ICOSLG Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h2-icoslg-protein-human-hek293-his.html

Purity

95.00

Smiles

DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSHHHHHHHHHH

Molecular Formula

23308 (Gene_ID) O75144-1 (D19-S258) (Accession)

Molecular Weight

45-55 kDa

References & Citations

[1]Wang B, et al. Effects of ICOSLG expressed in mouse hematological neoplasm cell lines in the GVL reaction. Bone Marrow Transplant. 2013 Jan;48 (1) :124-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal GRK4 Antibody (OTI4F5) [CoraFluor 1]
NBP2-70845CL1 0.1 mL

Mouse Monoclonal GRK4 Antibody (OTI4F5) [CoraFluor 1]

Sign In for Pricing
View Details
RBM23, ID (RBM23, RNPC4, Probable RNA-binding protein 23, RNA-binding motif protein 23, RNA-binding region-containing protein 4, Splicing factor SF2) (FITC)
MBS6340721-01 0.2 mL

RBM23, ID (RBM23, RNPC4, Probable RNA-binding protein 23, RNA-binding motif protein 23, RNA-binding region-containing protein 4, Splicing factor SF2) (FITC)

Sign In for Pricing
View Details
RBM23, ID (RBM23, RNPC4, Probable RNA-binding protein 23, RNA-binding motif protein 23, RNA-binding region-containing protein 4, Splicing factor SF2) (FITC)
MBS6340721-02 5x 0.2 mL

RBM23, ID (RBM23, RNPC4, Probable RNA-binding protein 23, RNA-binding motif protein 23, RNA-binding region-containing protein 4, Splicing factor SF2) (FITC)

Sign In for Pricing
View Details
WDR1 Rabbit pAb
E45R18841N-100 100 µL

WDR1 Rabbit pAb

Sign In for Pricing
View Details
Sodium sulfite
MF-0137579 100 g

Sodium sulfite

Sign In for Pricing
View Details
Recombinant Mouse CD6 Protein, C-His
EMD87601 100 μg

Recombinant Mouse CD6 Protein, C-His

Sign In for Pricing
View Details