Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H2/ICOSLG, Human (HEK293, His)

B7-H2/ICOSLG Protein, Human (HEK293, His) is a polypeptide chain containing the C-termimal His tag produced in HEK293 cells. ICOSLG is a number of the B7 family of co-stimulatory molecules.

Product Specifications

Product Name Alternative

B7-H2/ICOSLG Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h2-icoslg-protein-human-hek293-his.html

Purity

95.00

Smiles

DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSHHHHHHHHHH

Molecular Formula

23308 (Gene_ID) O75144-1 (D19-S258) (Accession)

Molecular Weight

45-55 kDa

References & Citations

[1]Wang B, et al. Effects of ICOSLG expressed in mouse hematological neoplasm cell lines in the GVL reaction. Bone Marrow Transplant. 2013 Jan;48 (1) :124-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-CDK1 (Tyr15) Rabbit pAb
E47R3092 100 µL

Phospho-CDK1 (Tyr15) Rabbit pAb

Sign In for Pricing
View Details
OR5B12, CT (OR5B12, OR5B12P, OR5B16, Olfactory receptor 5B12, Olfactory receptor 5B16, Olfactory receptor OR11-241) (MaxLight 750) discontinued
031174-ML750 100 µL

OR5B12, CT (OR5B12, OR5B12P, OR5B16, Olfactory receptor 5B12, Olfactory receptor 5B16, Olfactory receptor OR11-241) (MaxLight 750) discontinued

Sign In for Pricing
View Details
ERGIC2 (C-term) Rabbit Polyclonal Antibody
AP51452PU-N 400 µL

ERGIC2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 15 Polyclonal Antibody
MBS9243343-01 0.1 mL

Cytokeratin 15 Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 15 Polyclonal Antibody
MBS9243343-02 5x 0.1 mL

Cytokeratin 15 Polyclonal Antibody

Sign In for Pricing
View Details
96-Well Plate Cover Foil (Pierceable) (2 Foils)
C2007-2 2 PCS

96-Well Plate Cover Foil (Pierceable) (2 Foils)

Sign In for Pricing
View Details