Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H2/ICOSLG, Human (HEK293, His)

B7-H2/ICOSLG Protein, Human (HEK293, His) is a polypeptide chain containing the C-termimal His tag produced in HEK293 cells. ICOSLG is a number of the B7 family of co-stimulatory molecules.

Product Specifications

Product Name Alternative

B7-H2/ICOSLG Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h2-icoslg-protein-human-hek293-his.html

Purity

95.00

Smiles

DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSHHHHHHHHHH

Molecular Formula

23308 (Gene_ID) O75144-1 (D19-S258) (Accession)

Molecular Weight

45-55 kDa

References & Citations

[1]Wang B, et al. Effects of ICOSLG expressed in mouse hematological neoplasm cell lines in the GVL reaction. Bone Marrow Transplant. 2013 Jan;48 (1) :124-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Measles Phospho-Protein [9H4] - 100 μg
90019-100μg 100 µg

Anti-Measles Phospho-Protein [9H4] - 100 μg

Sign In for Pricing
View Details
Pumilio 2 Recombinant Antibody, HRP Conjugated
bsm-62204R-HRP-01 20 µL

Pumilio 2 Recombinant Antibody, HRP Conjugated

Sign In for Pricing
View Details
Pumilio 2 Recombinant Antibody, HRP Conjugated
bsm-62204R-HRP-02 100 µL

Pumilio 2 Recombinant Antibody, HRP Conjugated

Sign In for Pricing
View Details
FYB mouse mAb
UB-GEN-3385 100 µL

FYB mouse mAb

Sign In for Pricing
View Details
GSTM1 (NM_000561) Human Tagged ORF Clone Lentiviral Particle
RC223332L4V 200 µL

GSTM1 (NM_000561) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RPL5 (NM_000969) Human Tagged ORF Clone Lentiviral Particle
RC210734L1V 200 µL

RPL5 (NM_000969) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details