Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H2/ICOSLG, Human (HEK293, His)

B7-H2/ICOSLG Protein, Human (HEK293, His) is a polypeptide chain containing the C-termimal His tag produced in HEK293 cells. ICOSLG is a number of the B7 family of co-stimulatory molecules.

Product Specifications

Product Name Alternative

B7-H2/ICOSLG Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h2-icoslg-protein-human-hek293-his.html

Purity

95.00

Smiles

DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSHHHHHHHHHH

Molecular Formula

23308 (Gene_ID) O75144-1 (D19-S258) (Accession)

Molecular Weight

45-55 kDa

References & Citations

[1]Wang B, et al. Effects of ICOSLG expressed in mouse hematological neoplasm cell lines in the GVL reaction. Bone Marrow Transplant. 2013 Jan;48 (1) :124-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF280A Antibody
MBS5315794-01 0.1 mL

ZNF280A Antibody

Sign In for Pricing
View Details
ZNF280A Antibody
MBS5315794-02 5x 0.1 mL

ZNF280A Antibody

Sign In for Pricing
View Details
Topoisomerase II (TOP2) Rat ELISA Kit
H6742 96 Tests

Topoisomerase II (TOP2) Rat ELISA Kit

Sign In for Pricing
View Details
PDE1C (G-7) Alexa Fluor® 594
sc-376474 AF594 200 µg/mL

PDE1C (G-7) Alexa Fluor® 594

Sign In for Pricing
View Details
IL1A Protein Vector (Rat) (pPB-C-His)
PV274410 500 ng

IL1A Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Lentiviral mouse Ocm shRNA (UAS) - Lentiviral mouse Ocm shRNA (UAS) (25)
GTR15230777 1 Vial

Lentiviral mouse Ocm shRNA (UAS) - Lentiviral mouse Ocm shRNA (UAS) (25)

Sign In for Pricing
View Details