Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H2/ICOSLG, Human (HEK293, His)

B7-H2/ICOSLG Protein, Human (HEK293, His) is a polypeptide chain containing the C-termimal His tag produced in HEK293 cells. ICOSLG is a number of the B7 family of co-stimulatory molecules.

Product Specifications

Product Name Alternative

B7-H2/ICOSLG Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h2-icoslg-protein-human-hek293-his.html

Purity

95.00

Smiles

DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSHHHHHHHHHH

Molecular Formula

23308 (Gene_ID) O75144-1 (D19-S258) (Accession)

Molecular Weight

45-55 kDa

References & Citations

[1]Wang B, et al. Effects of ICOSLG expressed in mouse hematological neoplasm cell lines in the GVL reaction. Bone Marrow Transplant. 2013 Jan;48 (1) :124-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR2F6 Mouse Monoclonal Antibody [Clone ID: OTI2H4]
TA806787S 30 µL

NR2F6 Mouse Monoclonal Antibody [Clone ID: OTI2H4]

Sign In for Pricing
View Details
TSPY4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2815207 1.0 µg DNA

TSPY4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Epacmarstobart
MBS5824113 Inquire

Epacmarstobart

Sign In for Pricing
View Details
Rabbit Polyclonal MYH7 Antibody [Alexa Fluor 350]
NBP2-97775AF350 0.1 mL

Rabbit Polyclonal MYH7 Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
Recombinant Mouse Dkk1 Protein, His-tagged
Dkk1-15M 10 µg

Recombinant Mouse Dkk1 Protein, His-tagged

Sign In for Pricing
View Details
Genorise® Biotinylated Canine IgA polyclonal antibody
GR136015 50 µg

Genorise® Biotinylated Canine IgA polyclonal antibody

Sign In for Pricing
View Details