Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H2/ICOSLG, Human (HEK293, His)

B7-H2/ICOSLG Protein, Human (HEK293, His) is a polypeptide chain containing the C-termimal His tag produced in HEK293 cells. ICOSLG is a number of the B7 family of co-stimulatory molecules.

Product Specifications

Product Name Alternative

B7-H2/ICOSLG Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h2-icoslg-protein-human-hek293-his.html

Purity

95.00

Smiles

DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSHHHHHHHHHH

Molecular Formula

23308 (Gene_ID) O75144-1 (D19-S258) (Accession)

Molecular Weight

45-55 kDa

References & Citations

[1]Wang B, et al. Effects of ICOSLG expressed in mouse hematological neoplasm cell lines in the GVL reaction. Bone Marrow Transplant. 2013 Jan;48 (1) :124-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-RCCD1 antibody
SL13768R-01 50 µL

Rabbit Anti-RCCD1 antibody

Sign In for Pricing
View Details
Rabbit Anti-RCCD1 antibody
SL13768R-02 100 µL

Rabbit Anti-RCCD1 antibody

Sign In for Pricing
View Details
2,3-diamino-5-fluorobenzoic acid
sc-343350A 1 g

2,3-diamino-5-fluorobenzoic acid

Sign In for Pricing
View Details
Cpq Mouse qPCR Primer Pair (NM_176073)
MP220106 200 Reactions

Cpq Mouse qPCR Primer Pair (NM_176073)

Sign In for Pricing
View Details
GABARAPL2 Knockout jurkat Polyclonal Cells
ARG13784 1 Million

GABARAPL2 Knockout jurkat Polyclonal Cells

Sign In for Pricing
View Details
Recombinant Escherichia coli O7:K1 FMN reductase (NADH) RutF
MBS1193977-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O7:K1 FMN reductase (NADH) RutF

Sign In for Pricing
View Details