Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H2/ICOSLG, Human (HEK293, His)

B7-H2/ICOSLG Protein, Human (HEK293, His) is a polypeptide chain containing the C-termimal His tag produced in HEK293 cells. ICOSLG is a number of the B7 family of co-stimulatory molecules.

Product Specifications

Product Name Alternative

B7-H2/ICOSLG Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h2-icoslg-protein-human-hek293-his.html

Purity

95.00

Smiles

DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSHHHHHHHHHH

Molecular Formula

23308 (Gene_ID) O75144-1 (D19-S258) (Accession)

Molecular Weight

45-55 kDa

References & Citations

[1]Wang B, et al. Effects of ICOSLG expressed in mouse hematological neoplasm cell lines in the GVL reaction. Bone Marrow Transplant. 2013 Jan;48 (1) :124-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Izumo1 3'UTR GFP Stable Cell Line
TU256463 1.0 mL

Izumo1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
CMTM6 Antibody
KC-315-01 50 μL

CMTM6 Antibody

Sign In for Pricing
View Details
CMTM6 Antibody
KC-315-02 100 µL

CMTM6 Antibody

Sign In for Pricing
View Details
CMTM6 Antibody
KC-315-03 1 mL

CMTM6 Antibody

Sign In for Pricing
View Details
Mtmr1 (NM_001191725) Rat Tagged ORF Clone
RR217075 10 µg

Mtmr1 (NM_001191725) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Lentiviral human ZNHIT2 shRNA (UAS) - Lentiviral human ZNHIT2 shRNA (UAS, RFP) plasmid
GTR15320044 1 Vial

Lentiviral human ZNHIT2 shRNA (UAS) - Lentiviral human ZNHIT2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details