Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B7-H2/ICOSLG, Human (HEK293, His)

B7-H2/ICOSLG Protein, Human (HEK293, His) is a polypeptide chain containing the C-termimal His tag produced in HEK293 cells. ICOSLG is a number of the B7 family of co-stimulatory molecules.

Product Specifications

Product Name Alternative

B7-H2/ICOSLG Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/b7-h2-icoslg-protein-human-hek293-his.html

Purity

95.00

Smiles

DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSHHHHHHHHHH

Molecular Formula

23308 (Gene_ID) O75144-1 (D19-S258) (Accession)

Molecular Weight

45-55 kDa

References & Citations

[1]Wang B, et al. Effects of ICOSLG expressed in mouse hematological neoplasm cell lines in the GVL reaction. Bone Marrow Transplant. 2013 Jan;48 (1) :124-8.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMD10 (NM_170750) Human Recombinant Protein
TP317359L 1 mg

PSMD10 (NM_170750) Human Recombinant Protein

Sign In for Pricing
View Details
Lentiviral human MRPL28 shRNA (UAS) - Lentiviral human MRPL28 shRNA (UAS, iRFP) (100)
GTR15350346 1 Vial

Lentiviral human MRPL28 shRNA (UAS) - Lentiviral human MRPL28 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Monoclonal PGP9.5 / UchL1 (pan-Neuronal Marker) Antibody - Without BSA and Azide, Clone: 13C4
APG03086G 0.1mg

Monoclonal PGP9.5 / UchL1 (pan-Neuronal Marker) Antibody - Without BSA and Azide, Clone: 13C4

Sign In for Pricing
View Details
Irak3 Mouse Gene Knockout Kit (CRISPR)
KN308417BN 1 Kit

Irak3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human FASN knockout cell line
ABC-KH5351 1 Vial

Human FASN knockout cell line

Sign In for Pricing
View Details
CEP128 (NM_152446) Human Tagged ORF Clone
RG220088 10 µg

CEP128 (NM_152446) Human Tagged ORF Clone

Sign In for Pricing
View Details