Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EphB2, Human (sf9, His-GST)

EphB2 protein is a receptor tyrosine kinase that participates in bidirectional signaling with the transmembrane ephrin B ligand. It guides commissural axons in the developing cerebral cortex, efferent growth cones of the inner ear, and retinal ganglion cell axons. EphB2 Protein, Human (sf9, His-GST) is the recombinant human-derived EphB2 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Product Specifications

Product Name Alternative

EphB2 Protein, Human (sf9, His-GST), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ephb2-protein-human-sf9-his-gst.html

Smiles

GFERADSEYTDKLQHYTSGHMTPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEV

Molecular Formula

2048 (Gene_ID) P29323-3 (G570-V987) (Accession)

Molecular Weight

Approximately 65 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHD2 (Prolyl Hydroxylase Domain-Containing Protein 2) BioAssayTM ELISA Kit (Human) discontinued
519424 96 Tests

PHD2 (Prolyl Hydroxylase Domain-Containing Protein 2) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
Rat CD152 Antibody
OASA03856-250UG 0.25 mg

Rat CD152 Antibody

Sign In for Pricing
View Details
Nop2 Mouse shRNA Plasmid (Locus ID 110109)
TR505920 1 Kit

Nop2 Mouse shRNA Plasmid (Locus ID 110109)

Sign In for Pricing
View Details
Gga3 3'UTR Luciferase Stable Cell Line
TU107030 1.0 mL

Gga3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Tdp1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
46447114 3x 1.0 µg

Tdp1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
GTF2H3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0916908 1.0 µg DNA

GTF2H3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details