Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EphB2, Human (sf9, His-GST)

EphB2 protein is a receptor tyrosine kinase that participates in bidirectional signaling with the transmembrane ephrin B ligand. It guides commissural axons in the developing cerebral cortex, efferent growth cones of the inner ear, and retinal ganglion cell axons. EphB2 Protein, Human (sf9, His-GST) is the recombinant human-derived EphB2 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Product Specifications

Product Name Alternative

EphB2 Protein, Human (sf9, His-GST), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ephb2-protein-human-sf9-his-gst.html

Smiles

GFERADSEYTDKLQHYTSGHMTPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEV

Molecular Formula

2048 (Gene_ID) P29323-3 (G570-V987) (Accession)

Molecular Weight

Approximately 65 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Cbz-6-oxo-2-azaspiro[3.3]heptane
OR317205 1 Each

2-Cbz-6-oxo-2-azaspiro[3.3]heptane

Sign In for Pricing
View Details
Recombinant Myozenin 2 (MYOZ2)
TRV-0010612-01 10 µg

Recombinant Myozenin 2 (MYOZ2)

Sign In for Pricing
View Details
Recombinant Myozenin 2 (MYOZ2)
TRV-0010612-02 50 µg

Recombinant Myozenin 2 (MYOZ2)

Sign In for Pricing
View Details
Recombinant Myozenin 2 (MYOZ2)
TRV-0010612-03 100 µg

Recombinant Myozenin 2 (MYOZ2)

Sign In for Pricing
View Details
Recombinant Myozenin 2 (MYOZ2)
TRV-0010612-04 200 µg

Recombinant Myozenin 2 (MYOZ2)

Sign In for Pricing
View Details
Recombinant Myozenin 2 (MYOZ2)
TRV-0010612-05 500 µg

Recombinant Myozenin 2 (MYOZ2)

Sign In for Pricing
View Details