Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FSH beta, Human (HEK293, His)

The FSH beta protein and the alpha chain CGA form follicle-stimulating hormone, which gives the hormone heterodimer biological specificity. It binds to FSHR on target cells and initiates downstream signaling, which is critical for follicle development and spermatogenesis. FSH beta Protein, Human (HEK293, His) is the recombinant human-derived FSH beta protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

FSH beta Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fsh-beta-protein-human-hek-293-his.html

Purity

98.0

Smiles

NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE

Molecular Formula

2488 (Gene_ID) P01225 (N19-E129) (Accession)

Molecular Weight

Approximately 21.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TP53AP1 (TP53TG1) Human qPCR Primer Pair (NM_007233)
HP209995 200 Reactions

TP53AP1 (TP53TG1) Human qPCR Primer Pair (NM_007233)

Sign In for Pricing
View Details
IL17F (Interleukin-17F, IL-17F, Cytokine ML-1, Interleukin-24, IL-24, IL24) (APC)
I8439-28K-APC 100 µL

IL17F (Interleukin-17F, IL-17F, Cytokine ML-1, Interleukin-24, IL-24, IL24) (APC)

Sign In for Pricing
View Details
PD-1/PD-L1-IN-54
HY-159892 1 Each

PD-1/PD-L1-IN-54

Sign In for Pricing
View Details
Anti-Phospho-HER2/ERBB2 (Thr686) Polyclonal Antibody
TMAC-02776-01 50 μL

Anti-Phospho-HER2/ERBB2 (Thr686) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Phospho-HER2/ERBB2 (Thr686) Polyclonal Antibody
TMAC-02776-02 100 µL

Anti-Phospho-HER2/ERBB2 (Thr686) Polyclonal Antibody

Sign In for Pricing
View Details
ABCA4 rabbit pAb
ES10155-01 50 µL

ABCA4 rabbit pAb

Sign In for Pricing
View Details