Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SARS-CoV S (HEK293, His-Myc)

The SARS-CoV S protein coordinates viral entry by interacting with human ACE2 and CLEC4M/DC-SIGNR receptors to attach viral particles to the cell membrane. It downregulates host tethering protein (BST2) through lysosomal degradation, antagonizing its antiviral activity. SARS-CoV S Protein (HEK293, His-Myc) is the recombinant Virus-derived SARS-CoV S protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

SARS-CoV S Protein (HEK293, His-Myc), Virus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sars-cov-s-protein-hek-293-his-myc.html

Purity

95.0

Smiles

RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF

Molecular Formula

1489668 (Gene_ID) P59594 (R306-F527) (Accession)

Molecular Weight

Approximately 37 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal PDE4B Antibody (C-Terminus)
APM07056G 0.05mg

Polyclonal PDE4B Antibody (C-Terminus)

Sign In for Pricing
View Details
RPS16P4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2035105 3x 1.0 µg

RPS16P4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal Hepatitis E Virus Antibody [mFluor Violet 450 SE]
NB100-93583MFV450 0.1 mL

Rabbit Polyclonal Hepatitis E Virus Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 anti-human CD324 (E-Cadherin)
GT10164 100 Tests

PerCP/Cyanine5.5 anti-human CD324 (E-Cadherin)

Sign In for Pricing
View Details
Anti-H2AX Antibody (6B770)
TMAB-06861-01 50 μL

Anti-H2AX Antibody (6B770)

Sign In for Pricing
View Details
Anti-H2AX Antibody (6B770)
TMAB-06861-02 100 µL

Anti-H2AX Antibody (6B770)

Sign In for Pricing
View Details