Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FCRL6, Human (His)

The FCRL6 protein acts as a receptor for MHC class II and interacts with HLA-DR when specific beta chains are associated. Although independent stimulation of FCRL6 does not promote cytokine production or cytotoxic activity, it exhibits tyrosine phosphorylation interactions with proteins such as PTPN11, PTPN6, INPP5D, INPPL1, and GRB2. FCRL6 Protein, Human (His) is the recombinant human-derived FCRL6 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

FCRL6 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fcrl6-protein-human-his.html

Purity

98.0

Smiles

LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW

Molecular Formula

343413 (Gene_ID) Q6DN72-1 (L20-W307) (Accession)

Molecular Weight

Approximately 33-36 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal CD7 Antibody (CD7/3868R) [PE]
NBP3-24056PE 0.1 mL

Rabbit Monoclonal CD7 Antibody (CD7/3868R) [PE]

Sign In for Pricing
View Details
Map3k3 (NM_011947) Mouse Tagged ORF Clone Lentiviral Particle
MR209547L4V 200 µL

Map3k3 (NM_011947) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Ep-CAM (CD326, Adenocarcinoma-associated Antigen, Cell Surface Glycoprotein Trop-1, EGP2, EGP314, EGP40, Epithelial Cell Adhesion Molecule, Epithelial Glycoprotein 314, ESA, KSA, TACD1, TACSTD1, TROP1, Tumor-associated Calcium Signal Transducer 1, ECS-1,
MBS6123132-01 0.1 mL

Ep-CAM (CD326, Adenocarcinoma-associated Antigen, Cell Surface Glycoprotein Trop-1, EGP2, EGP314, EGP40, Epithelial Cell Adhesion Molecule, Epithelial Glycoprotein 314, ESA, KSA, TACD1, TACSTD1, TROP1, Tumor-associated Calcium Signal Transducer 1, ECS-1,

Sign In for Pricing
View Details
Ep-CAM (CD326, Adenocarcinoma-associated Antigen, Cell Surface Glycoprotein Trop-1, EGP2, EGP314, EGP40, Epithelial Cell Adhesion Molecule, Epithelial Glycoprotein 314, ESA, KSA, TACD1, TACSTD1, TROP1, Tumor-associated Calcium Signal Transducer 1, ECS-1,
MBS6123132-02 5x 0.1 mL

Ep-CAM (CD326, Adenocarcinoma-associated Antigen, Cell Surface Glycoprotein Trop-1, EGP2, EGP314, EGP40, Epithelial Cell Adhesion Molecule, Epithelial Glycoprotein 314, ESA, KSA, TACD1, TACSTD1, TROP1, Tumor-associated Calcium Signal Transducer 1, ECS-1,

Sign In for Pricing
View Details
Gsk3a (NM_017344) Rat Tagged Lenti ORF Clone
RR201401L4 10 µg

Gsk3a (NM_017344) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rat Arsg ELISA Kit
ELI-23989r 96 Tests

Rat Arsg ELISA Kit

Sign In for Pricing
View Details