Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FCRL6, Human (His)

The FCRL6 protein acts as a receptor for MHC class II and interacts with HLA-DR when specific beta chains are associated. Although independent stimulation of FCRL6 does not promote cytokine production or cytotoxic activity, it exhibits tyrosine phosphorylation interactions with proteins such as PTPN11, PTPN6, INPP5D, INPPL1, and GRB2. FCRL6 Protein, Human (His) is the recombinant human-derived FCRL6 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

FCRL6 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fcrl6-protein-human-his.html

Purity

98.0

Smiles

LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW

Molecular Formula

343413 (Gene_ID) Q6DN72-1 (L20-W307) (Accession)

Molecular Weight

Approximately 33-36 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TUBA3E (NM_207312) Human Mass Spec Standard
PH309279 10 µg

TUBA3E (NM_207312) Human Mass Spec Standard

Sign In for Pricing
View Details
Gm7714 3'UTR GFP Stable Cell Line
TU158598 1.0 mL

Gm7714 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Actl6a (Actin-like Protein 6A, 53kD BRG1-Associated Factor A, Actin-Related Protein Baf53a, BRG1-Associated Factor 53A, BAF53A, Actl6a, Actl6, Baf53a) (MaxLight 650) discontinued
302242-ML650 100 µL

Actl6a (Actin-like Protein 6A, 53kD BRG1-Associated Factor A, Actin-Related Protein Baf53a, BRG1-Associated Factor 53A, BAF53A, Actl6a, Actl6, Baf53a) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Anti-POLR2C antibody
PAab06621 100 µg

Anti-POLR2C antibody

Sign In for Pricing
View Details
Rabbit Monoclonal PLA2G1B Antibody (004) [mFluor Violet 500 SE]
NBP2-90538MFV500 0.1 mL

Rabbit Monoclonal PLA2G1B Antibody (004) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
TOB1 ORF Vector (Human) (pORF)
ORF010841 1.0 µg DNA

TOB1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details