Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FCRL6, Human (His)

The FCRL6 protein acts as a receptor for MHC class II and interacts with HLA-DR when specific beta chains are associated. Although independent stimulation of FCRL6 does not promote cytokine production or cytotoxic activity, it exhibits tyrosine phosphorylation interactions with proteins such as PTPN11, PTPN6, INPP5D, INPPL1, and GRB2. FCRL6 Protein, Human (His) is the recombinant human-derived FCRL6 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

FCRL6 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fcrl6-protein-human-his.html

Purity

98.0

Smiles

LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW

Molecular Formula

343413 (Gene_ID) Q6DN72-1 (L20-W307) (Accession)

Molecular Weight

Approximately 33-36 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCAKD sgRNA CRISPR Lentivector (Human) (Target 2)
K0564103 1.0 µg DNA

DCAKD sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
OR8H3 Rabbit pAb
E47R18004 100 µL

OR8H3 Rabbit pAb

Sign In for Pricing
View Details
MRPS21 (NM_031901) Human Tagged Lenti ORF Clone
RC203193L4 10 µg

MRPS21 (NM_031901) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RNF32 CytoSection
TS429940P5 25 Slides

RNF32 CytoSection

Sign In for Pricing
View Details
Ephrin B2 (EFNB2) BioAssayTM ELISA Kit (Human)
024841 96 Tests

Ephrin B2 (EFNB2) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Mouse Monoclonal TDO2 Antibody (1C8)
H00006999-M01 0.1 mg

Mouse Monoclonal TDO2 Antibody (1C8)

Sign In for Pricing
View Details