Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FCRL6, Human (His)

The FCRL6 protein acts as a receptor for MHC class II and interacts with HLA-DR when specific beta chains are associated. Although independent stimulation of FCRL6 does not promote cytokine production or cytotoxic activity, it exhibits tyrosine phosphorylation interactions with proteins such as PTPN11, PTPN6, INPP5D, INPPL1, and GRB2. FCRL6 Protein, Human (His) is the recombinant human-derived FCRL6 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

FCRL6 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fcrl6-protein-human-his.html

Purity

98.0

Smiles

LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW

Molecular Formula

343413 (Gene_ID) Q6DN72-1 (L20-W307) (Accession)

Molecular Weight

Approximately 33-36 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Genorise® Recombinant bovine BMP-1
GR104067 5 µg

Genorise® Recombinant bovine BMP-1

Sign In for Pricing
View Details
SLC5A9 Antibody
A74198-50UL 50 μL

SLC5A9 Antibody

Sign In for Pricing
View Details
PYGO1 Human Gene Knockout Kit (CRISPR)
KN420331 1 Kit

PYGO1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZBED4 Protein Vector (Mouse) (pPM-C-His)
PV248209 500 ng

ZBED4 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Rat Haus5 Pre-designed siRNA Set A
SI206118A 1 Each

Rat Haus5 Pre-designed siRNA Set A

Sign In for Pricing
View Details
CIAO1 Polyclonal Antibody
E55A04847 100 µg

CIAO1 Polyclonal Antibody

Sign In for Pricing
View Details