Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FCRL6, Human (His)

The FCRL6 protein acts as a receptor for MHC class II and interacts with HLA-DR when specific beta chains are associated. Although independent stimulation of FCRL6 does not promote cytokine production or cytotoxic activity, it exhibits tyrosine phosphorylation interactions with proteins such as PTPN11, PTPN6, INPP5D, INPPL1, and GRB2. FCRL6 Protein, Human (His) is the recombinant human-derived FCRL6 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

FCRL6 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fcrl6-protein-human-his.html

Purity

98.0

Smiles

LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW

Molecular Formula

343413 (Gene_ID) Q6DN72-1 (L20-W307) (Accession)

Molecular Weight

Approximately 33-36 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,2-Dimyristoyl-sn-glycerol discontinued. See 273917
410733-01 250 mg

1,2-Dimyristoyl-sn-glycerol discontinued. See 273917

Sign In for Pricing
View Details
1,2-Dimyristoyl-sn-glycerol discontinued. See 273917
410733-02 500 mg

1,2-Dimyristoyl-sn-glycerol discontinued. See 273917

Sign In for Pricing
View Details
C-C Motif Chemokine 22 (CCL22) Antibody Pair
abx370143-01 5x 96 Tests

C-C Motif Chemokine 22 (CCL22) Antibody Pair

Sign In for Pricing
View Details
C-C Motif Chemokine 22 (CCL22) Antibody Pair
abx370143-02 10x 96 Tests

C-C Motif Chemokine 22 (CCL22) Antibody Pair

Sign In for Pricing
View Details
Rabbit P-Selectin (P-Sel) ELISA kit
EIA06279Rb 1 Kit

Rabbit P-Selectin (P-Sel) ELISA kit

Sign In for Pricing
View Details
ASF1B
552449 100 µL

ASF1B

Sign In for Pricing
View Details