Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FCRL6, Human (His)

The FCRL6 protein acts as a receptor for MHC class II and interacts with HLA-DR when specific beta chains are associated. Although independent stimulation of FCRL6 does not promote cytokine production or cytotoxic activity, it exhibits tyrosine phosphorylation interactions with proteins such as PTPN11, PTPN6, INPP5D, INPPL1, and GRB2. FCRL6 Protein, Human (His) is the recombinant human-derived FCRL6 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

FCRL6 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fcrl6-protein-human-his.html

Purity

98.0

Smiles

LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW

Molecular Formula

343413 (Gene_ID) Q6DN72-1 (L20-W307) (Accession)

Molecular Weight

Approximately 33-36 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ALK knockout cell line
ABC-KH0535 1 Vial

Human ALK knockout cell line

Sign In for Pricing
View Details
GSTA4 Antibody, FITC conjugated
A24053-50UG 50 µg

GSTA4 Antibody, FITC conjugated

Sign In for Pricing
View Details
Recombinant Niviventer culturatus Cytochrome c oxidase subunit 2 (MT-CO2), partial
MBS7077554 Inquire

Recombinant Niviventer culturatus Cytochrome c oxidase subunit 2 (MT-CO2), partial

Sign In for Pricing
View Details
Ribosomal Protein S6 Kinase 1 (RPS6K1) (Biotin) discontinued
R2031-39F-Biotin 100 µL

Ribosomal Protein S6 Kinase 1 (RPS6K1) (Biotin) discontinued

Sign In for Pricing
View Details
TQB3804 (EGFR-IN-7) 25mg
A18562-25 25 mg

TQB3804 (EGFR-IN-7) 25mg

Sign In for Pricing
View Details
EPS15 (NM_001159969) Human Over-expression Lysate
LY431502 100 µg

EPS15 (NM_001159969) Human Over-expression Lysate

Sign In for Pricing
View Details