Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FCRL6, Human (His)

The FCRL6 protein acts as a receptor for MHC class II and interacts with HLA-DR when specific beta chains are associated. Although independent stimulation of FCRL6 does not promote cytokine production or cytotoxic activity, it exhibits tyrosine phosphorylation interactions with proteins such as PTPN11, PTPN6, INPP5D, INPPL1, and GRB2. FCRL6 Protein, Human (His) is the recombinant human-derived FCRL6 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

FCRL6 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fcrl6-protein-human-his.html

Purity

98.0

Smiles

LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW

Molecular Formula

343413 (Gene_ID) Q6DN72-1 (L20-W307) (Accession)

Molecular Weight

Approximately 33-36 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal MKRN1 Antibody (OTI3F9) [DyLight 405]
NBP2-72716V 0.1 mL

Mouse Monoclonal MKRN1 Antibody (OTI3F9) [DyLight 405]

Sign In for Pricing
View Details
Anti-VWC2 Antibody, Rabbit Polyclonal
MBS8106139-01 0.1 mL

Anti-VWC2 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-VWC2 Antibody, Rabbit Polyclonal
MBS8106139-02 5x 0.1 mL

Anti-VWC2 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Guinea pig major histocompatibility complex,MHC/GPLA ELISA Kit
CN-00247G1 96T

Guinea pig major histocompatibility complex,MHC/GPLA ELISA Kit

Sign In for Pricing
View Details
BCLW Antibody
MBS8587838-01 0.1 mg

BCLW Antibody

Sign In for Pricing
View Details
BCLW Antibody
MBS8587838-02 0.1 mL (AF405L)

BCLW Antibody

Sign In for Pricing
View Details