Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FCRL6, Human (His)

The FCRL6 protein acts as a receptor for MHC class II and interacts with HLA-DR when specific beta chains are associated. Although independent stimulation of FCRL6 does not promote cytokine production or cytotoxic activity, it exhibits tyrosine phosphorylation interactions with proteins such as PTPN11, PTPN6, INPP5D, INPPL1, and GRB2. FCRL6 Protein, Human (His) is the recombinant human-derived FCRL6 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

FCRL6 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fcrl6-protein-human-his.html

Purity

98.0

Smiles

LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW

Molecular Formula

343413 (Gene_ID) Q6DN72-1 (L20-W307) (Accession)

Molecular Weight

Approximately 33-36 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PI4K2A, CT (PI4K2A, Phosphatidylinositol 4-kinase type 2-alpha, Phosphatidylinositol 4-kinase type II-alpha) (MaxLight 405) discontinued
040006-ML405 100 µL

PI4K2A, CT (PI4K2A, Phosphatidylinositol 4-kinase type 2-alpha, Phosphatidylinositol 4-kinase type II-alpha) (MaxLight 405) discontinued

Sign In for Pricing
View Details
1-D-Ribofuranosyl-3-guanylurea (Alpha/Beta-Mixture)
TRC-R415600-2.5MG 2.5 mg

1-D-Ribofuranosyl-3-guanylurea (Alpha/Beta-Mixture)

Sign In for Pricing
View Details
Rabbit Monoclonal Cytokeratin 14 Antibody (KRT14/6987R)
NBP3-20267-100ug 100 µg

Rabbit Monoclonal Cytokeratin 14 Antibody (KRT14/6987R)

Sign In for Pricing
View Details
Nlrc3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4784908 1.0 µg DNA

Nlrc3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
GNB4 3'UTR Luciferase Stable Cell Line
TU008988 1.0 mL

GNB4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
OR6K2 Blocking Peptide
MBS9625287-01 1 mg

OR6K2 Blocking Peptide

Sign In for Pricing
View Details