Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FCRL6, Human (His)

The FCRL6 protein acts as a receptor for MHC class II and interacts with HLA-DR when specific beta chains are associated. Although independent stimulation of FCRL6 does not promote cytokine production or cytotoxic activity, it exhibits tyrosine phosphorylation interactions with proteins such as PTPN11, PTPN6, INPP5D, INPPL1, and GRB2. FCRL6 Protein, Human (His) is the recombinant human-derived FCRL6 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

FCRL6 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fcrl6-protein-human-his.html

Purity

98.0

Smiles

LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW

Molecular Formula

343413 (Gene_ID) Q6DN72-1 (L20-W307) (Accession)

Molecular Weight

Approximately 33-36 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Edn2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3710808 1.0 µg DNA

Edn2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
pcDNA3.0-Magneto2.0-p2A-mCherry Plasmid
PVT55396 2 µg

pcDNA3.0-Magneto2.0-p2A-mCherry Plasmid

Sign In for Pricing
View Details
MAGEA4 Antibody, FITC conjugated
A27949-50UG 50 µg

MAGEA4 Antibody, FITC conjugated

Sign In for Pricing
View Details
HSF4, NT (HSF4, Heat shock factor protein 4, Heat shock transcription factor 4) (PE) discontinued
036791-PE 200 µL

HSF4, NT (HSF4, Heat shock factor protein 4, Heat shock transcription factor 4) (PE) discontinued

Sign In for Pricing
View Details
ZNF566 3'UTR GFP Stable Cell Line
TU079265 1.0 mL

ZNF566 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rabbit anti-Escherichia fergusonii (strain 35469/DSM 13698/CDC 0568-73) DXS Polyclonal Antibody
MBS7175330 Inquire

Rabbit anti-Escherichia fergusonii (strain 35469/DSM 13698/CDC 0568-73) DXS Polyclonal Antibody

Sign In for Pricing
View Details