Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FCRL6, Human (His)

The FCRL6 protein acts as a receptor for MHC class II and interacts with HLA-DR when specific beta chains are associated. Although independent stimulation of FCRL6 does not promote cytokine production or cytotoxic activity, it exhibits tyrosine phosphorylation interactions with proteins such as PTPN11, PTPN6, INPP5D, INPPL1, and GRB2. FCRL6 Protein, Human (His) is the recombinant human-derived FCRL6 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

FCRL6 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fcrl6-protein-human-his.html

Purity

98.0

Smiles

LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW

Molecular Formula

343413 (Gene_ID) Q6DN72-1 (L20-W307) (Accession)

Molecular Weight

Approximately 33-36 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-FYB antibody
STJ99143 200 µl

Anti-FYB antibody

Sign In for Pricing
View Details
SCFD1 (NM_182835) Human 3' UTR Clone
SC202565 10 µg

SCFD1 (NM_182835) Human 3' UTR Clone

Sign In for Pricing
View Details
MSGN1 (NM_001105569) Human Tagged ORF Clone Lentiviral Particle
RC225212L4V 200 µL

MSGN1 (NM_001105569) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CCDC83 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-8087R-BF405 100 µL

CCDC83 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
PPHLN1 Polyclonal Antibody, PE Conjugated
bs-7872R-PE 100 µL

PPHLN1 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Telomere repeat-binding protein 1 (TRP1) , partial
MBS1303479-01 0.05 mg (E-Coli)

Recombinant Arabidopsis thaliana Telomere repeat-binding protein 1 (TRP1) , partial

Sign In for Pricing
View Details