Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FCRL6, Human (His)

The FCRL6 protein acts as a receptor for MHC class II and interacts with HLA-DR when specific beta chains are associated. Although independent stimulation of FCRL6 does not promote cytokine production or cytotoxic activity, it exhibits tyrosine phosphorylation interactions with proteins such as PTPN11, PTPN6, INPP5D, INPPL1, and GRB2. FCRL6 Protein, Human (His) is the recombinant human-derived FCRL6 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

FCRL6 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fcrl6-protein-human-his.html

Purity

98.0

Smiles

LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW

Molecular Formula

343413 (Gene_ID) Q6DN72-1 (L20-W307) (Accession)

Molecular Weight

Approximately 33-36 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL
BNC880050-500 1x 500 µL

IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF740 conjugate, 0.1mg/mL
BNC740266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF640R conjugate, 0.1mg/mL
BNC400189-500 1x 500 µL

CD74 (BU45), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL
BNC400391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/2580), CF640R conjugate, 0.1mg/mL
BNC402580-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/2580), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1373), CF740 conjugate, 0.1mg/mL
BNC741373-100 1x 100 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1373), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details