Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Muellerian-inhibiting factor/AMH, Mouse (P.pastoris, His)

Mullerian inhibitory factor (AMH) plays a crucial role in various reproductive processes. It contributes significantly to Mullerian duct degeneration in male fetal sex differentiation. Muellerian-inhibiting factor/AMH Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Muellerian-inhibiting factor/AMH protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

Muellerian-inhibiting factor/AMH Protein, Mouse (P.pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/muellerian-inhibiting-factor-amh-protein-mouse-p-pastoris-his.html

Purity

98.00

Smiles

DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC

Molecular Formula

11705 (Gene_ID) P27106 (D450-C552) (Accession)

Molecular Weight

Approximately 24 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Saccharomyces cerevisiae Threonine synthase (THR4) , partial
MBS1227340 Inquire

Recombinant Saccharomyces cerevisiae Threonine synthase (THR4) , partial

Sign In for Pricing
View Details
MRPS22 Polyclonal Antibody, FITC Conjugated
bs-12705R-FITC 100 µL

MRPS22 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
SNAI1/SNAIL-1 Antibody
orb1535325 50 μL

SNAI1/SNAIL-1 Antibody

Sign In for Pricing
View Details
MN9D
ARI0226 1 Million

MN9D

Sign In for Pricing
View Details
Glass Beads 0.1mm RNase Free
GB01-RNA 4 mL

Glass Beads 0.1mm RNase Free

Sign In for Pricing
View Details
IGHM Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV711310 1.0 µg DNA

IGHM Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details