Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG-4, Human (HEK293, His)

REG-4 is a calcium-independent lectin with mannose-binding specificity that retains carbohydrate recognition activity even in acidic environments. Its ability to act independently of calcium indicates its potent and versatile lectin activity. REG-4 Protein, Human (HEK293, His) is the recombinant human-derived REG-4 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

REG-4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg4-protein-human-hek-293-his.html

Purity

98.0

Smiles

DIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP

Molecular Formula

83998 (Gene_ID) Q9BYZ8-1 (D23-P158) (Accession)

Molecular Weight

Approximately 16.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EEF1AL8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
56834111 3x 1.0 µg

EEF1AL8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Lentiviral human FKBP2 shRNA (UAS) - Lentiviral human FKBP2 shRNA (UAS) (100)
GTR15130410 1 Vial

Lentiviral human FKBP2 shRNA (UAS) - Lentiviral human FKBP2 shRNA (UAS) (100)

Sign In for Pricing
View Details
LOC645277 Antibody Blocking peptide
orb1458044 500 µg

LOC645277 Antibody Blocking peptide

Sign In for Pricing
View Details
RAGE Recombinant Rabbit mAb
E47M52809 100 µL

RAGE Recombinant Rabbit mAb

Sign In for Pricing
View Details
RPL29P1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1955206 1.0 µg DNA

RPL29P1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Arhgap30 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4276107 1.0 µg DNA

Arhgap30 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details