Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LMCD1, Human (His)

The LMCD1 protein is a transcriptional cofactor that regulates GATA6 by blocking its DNA binding, thereby inhibiting transcriptional activation in lung and heart tissues. It inhibits GATA6-mediated transactivation of tissue-specific promoters, which is critical for developmental processes. LMCD1 Protein, Human (His) is the recombinant human-derived LMCD1 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

Product Specifications

Product Name Alternative

LMCD1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lmcd1-protein-human-his.html

Smiles

MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLTSDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKEKQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVTKGQLLCPTCSKSKRS

Molecular Formula

29995 (Gene_ID) Q9NZU5-1 (M1-S365) (Accession)

Molecular Weight

Approximately 45 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Salmonella newport Protein psiE (psiE)
MBS7028111-01 0.02 mg

Recombinant Salmonella newport Protein psiE (psiE)

Ask
View Details
Recombinant Salmonella newport Protein psiE (psiE)
MBS7028111-02 0.1 mg

Recombinant Salmonella newport Protein psiE (psiE)

Ask
View Details
Recombinant Salmonella newport Protein psiE (psiE)
MBS7028111-03 5x 0.1 mg

Recombinant Salmonella newport Protein psiE (psiE)

Ask
View Details
Mouse Monoclonal EGFR [p Tyr1068] Antibody (338324) [Janelia Fluor 669]
FAB3570JF669 0.1 mL

Mouse Monoclonal EGFR [p Tyr1068] Antibody (338324) [Janelia Fluor 669]

Ask
View Details
Jagged 1 Protein (JAG1) BioAssayTM ELISA Kit (Human)
026307-01 48 Tests

Jagged 1 Protein (JAG1) BioAssayTM ELISA Kit (Human)

Ask
View Details
Jagged 1 Protein (JAG1) BioAssayTM ELISA Kit (Human)
026307-02 96 Tests

Jagged 1 Protein (JAG1) BioAssayTM ELISA Kit (Human)

Ask
View Details