Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LMCD1, Human (His)

The LMCD1 protein is a transcriptional cofactor that regulates GATA6 by blocking its DNA binding, thereby inhibiting transcriptional activation in lung and heart tissues. It inhibits GATA6-mediated transactivation of tissue-specific promoters, which is critical for developmental processes. LMCD1 Protein, Human (His) is the recombinant human-derived LMCD1 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

Product Specifications

Product Name Alternative

LMCD1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lmcd1-protein-human-his.html

Smiles

MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLTSDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKEKQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVTKGQLLCPTCSKSKRS

Molecular Formula

29995 (Gene_ID) Q9NZU5-1 (M1-S365) (Accession)

Molecular Weight

Approximately 45 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PDK2 Blocking Peptide
MBS9624537-01 1 mg

PDK2 Blocking Peptide

Ask
View Details
PDK2 Blocking Peptide
MBS9624537-02 5x 1 mg

PDK2 Blocking Peptide

Ask
View Details
Mouse Anti-Mouse CD72.1
31-1982-0.5 0.5 mg

Mouse Anti-Mouse CD72.1

Ask
View Details
Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S) (D614G), partial, Active Protein
RPC28792-01 20 µg

Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S) (D614G), partial, Active Protein

Ask
View Details
Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S) (D614G), partial, Active Protein
RPC28792-02 100 µg

Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S) (D614G), partial, Active Protein

Ask
View Details
Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S) (D614G), partial, Active Protein
RPC28792-03 1 mg

Recombinant Severe acute respiratory syndrome coronavirus 2 Spike glycoprotein (S) (D614G), partial, Active Protein

Ask
View Details