Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC32, Human (HEK293, Fc)

LRRC32 is a key regulator of TGF-β activation and maintains TGFB1, TGFB2, and TGFB3 in the latent state during extracellular storage by binding to latency-associated peptide (LAP) . LRRC32 competes with LTBP1 for LAP binding and effectively regulates integrin-dependent TGF-β activation. LRRC32 Protein, Human (HEK293, Fc) is the recombinant human-derived LRRC32 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

LRRC32 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lrrc32-protein-human-hek-293-fc.html

Purity

97.60

Smiles

HQDKVPCKMVDKKVSCQVLGLLQVPSVLPPDTETLDLSGNQLRSILASPLGFYTALRHLDLSTNEISFLQPGAFQALTHLEHLSLAHNRLAMATALSAGGLGPLPRVTSLDLSGNSLYSGLLERLLGEAPSLHTLSLAENSLTRLTRHTFRDMPALEQLDLHSNVLMDIEDGAFEGLPRLTHLNLSRNSLTCISDFSLQQLRVLDLSCNSIEAFQTASQPQAEFQLTWLDLRENKLLHFPDLAALPRLIYLNLSNNLIRLPTGPPQDSKGIHAPSEGWSALPLSAPSGNASGRPLSQLLNLDLSYNEIELIPDSFLEHLTSLCFLNLSRNCLRTFEARRLGSLPCLMLLDLSHNALETLELGARALGSLRTLLLQGNALRDLPPYTFANLASLQRLNLQGNRVSPCGGPDEPGPSGCVAFSGITSLRSLSLVDNEIELLRAGAFLHTPLTELDLSSNPGLEVATGALGGLEASLEVLALQGNGLMVLQVDLPCFICLKRLNLAENRLSHLPAWTQAVSLEVLDLRNNSFSLLPGSAMGGLETSLRRLYLQGNPLSCCGNGWLAAQLHQGRVDVDATQDLICRFSSQEEVSLSHVRPEDCEKGGLKNIN

Molecular Formula

2615 (Gene_ID) Q14392 (H20-N627) (Accession)

Molecular Weight

104-110.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Phospholipase D2 (PLD2) ELISA Kit
MBS2705267-01 24 Strip Well

Human Phospholipase D2 (PLD2) ELISA Kit

Sign In for Pricing
View Details
Human Phospholipase D2 (PLD2) ELISA Kit
MBS2705267-02 48 Well

Human Phospholipase D2 (PLD2) ELISA Kit

Sign In for Pricing
View Details
Human Phospholipase D2 (PLD2) ELISA Kit
MBS2705267-03 96 Well

Human Phospholipase D2 (PLD2) ELISA Kit

Sign In for Pricing
View Details
Human Phospholipase D2 (PLD2) ELISA Kit
MBS2705267-04 5x 96 Well

Human Phospholipase D2 (PLD2) ELISA Kit

Sign In for Pricing
View Details
Human Phospholipase D2 (PLD2) ELISA Kit
MBS2705267-05 10x 96 Well

Human Phospholipase D2 (PLD2) ELISA Kit

Sign In for Pricing
View Details
Complement Component C3a Receptor (C3AR1) Antibody
abx339210-01 50 µL

Complement Component C3a Receptor (C3AR1) Antibody

Sign In for Pricing
View Details