IL-36 alpha/IL-1F6, Human

IL-36 alpha (IL-1F6), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 alpha mediates inflammatory response. IL-36 alpha binds to IL-36R and activates NF-κB and MAPK signaling pathways, but the activation requires N-terminal cleavage by neutrophil granule-derived proteases[1]. IL-36 alpha also binds to IL-1Rrp2 and recruit IL-1RAcP. IL-36 alpha activats the MAPK, Erk1/2 and JNK through IL-36R/IL-1RAcP[2]. IL-36 alpha/IL-1F6 Protein, Human is a recombinant human IL-36 alpha without any tag, which is produced in E. coli.

Product Specifications

Product Name Alternative

IL-36 alpha/IL-1F6 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-36-alpha-il-1f6-protein-human-153a-a.html

Purity

98.0

Smiles

KIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF

Molecular Formula

27179 (Gene_ID) Q9UHA7 (K6-F158) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Zhou L, et al. Interleukin-36: Structure, Signaling and Function. Adv Exp Med Biol. 2021;21:191-210.|[2]Gresnigt MS, et al. Biology of IL-36 cytokines and their role in disease. Semin Immunol. 2013 Dec 15;25 (6) :458-65.|[3]Murrieta-Coxca JM, et al. IL-36 Cytokines: Regulators of Inflammatory Responses and Their Emerging Role in Immunology of Reproduction. Int J Mol Sci. 2019 Apr 3;20 (7) :1649.|[4]Li JM, et al. IL-36α/IL-36RA/IL-38 signaling mediates inflammation and barrier disruption in human corneal epithelial cells under hyperosmotic stress. Ocul Surf. 2021 Oct;22:163-171. |[5]Higgins J, et al. IL-36α induces maturation of Th1-inducing human MDDC and synergises with IFN-γ to induce high surface expression of CD14 and CD11c. Hum Immunol. 2015 Apr;76 (4) :245-53.|[6]Chang L, et al. IL-36α suppresses proliferation of ovarian cancer cells. Tumour Biol. 2017 Jun;39 (6) :1010428317706918.