IFI27L2A, Mouse (Cell-Free, His)
The IFI27L2A protein critically regulates interferon-induced transcriptional activity, specifically NR4A1, NR4A2, and NR4A3. Its interaction with XPO1 enhances the nuclear export of these receptors, with potential vascular effects on the injury response. IFI27L2A Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived IFI27L2A protein, expressed by E. coli Cell-free , with N-10*His labeled tag.
Product Specifications
Product Name Alternative
IFI27L2A Protein, Mouse (Cell-Free, His), Mouse, E. coli Cell-free
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ifi27l2a-protein-mouse-cf-his.html
Purity
90.00
Smiles
AMGFTGTGIAAASIAAKMMSAAAIANGGGVAAGSLVATLQSAGVLGLSTSTNAILGAAGAAVGALL
Molecular Formula
76933 (Gene_ID) Q8R412 (A25-L90) (Accession)
Molecular Weight
11 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
![Rabbit Polyclonal CFTR Antibody [Biotin]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
IL-17A (Interleukin-17, Cytotoxic T-lymphocyte-associated antigen 8 and CTLA-8) (HRP)
Human Triggering Receptor Expresses on Myeloid Cells-1, TREM-1 ELISA Kit
Human Triggering Receptor Expresses on Myeloid Cells-1, TREM-1 ELISA Kit
Lentiviral mouse Dpep2 shRNA (UAS) - Lentiviral mouse Dpep2 shRNA (UAS, RFP) (100)