Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hemoglobin subunit theta-1/HBQ1, Human (His)

Hemoglobin subunit theta-1 (HBQ1) is a protein belonging to the globin family. Globulin is a group of proteins involved in oxygen transport and storage. Hemoglobin subunit theta-1/HBQ1 Protein, Human (His) is the recombinant human-derived Hemoglobin subunit theta-1/HBQ1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Hemoglobin subunit theta-1/HBQ1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hemoglobin-subunit-theta-1-hbq1-protein-human-his.html

Purity

95.47

Smiles

MALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHLDLSPGSSQVRAHGQKVADALSLAVERLDDLPHALSALSHLHACQLRVDPASFQLLGHCLLVTLARHYPGDFSPALQASLDKFLSHVISALVSEYR

Molecular Formula

3049 (Gene_ID) P09105 (M1-R142) (Accession)

Molecular Weight

15 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sartorius Filter Paper G292 110mm
SAR2032 100 / PCK

Sartorius Filter Paper G292 110mm

Sign In for Pricing
View Details
Anti-Human CDH11 Antibody (SAA1820)
HX212013-01 50 µg

Anti-Human CDH11 Antibody (SAA1820)

Sign In for Pricing
View Details
Anti-Human CDH11 Antibody (SAA1820)
HX212013-02 100 µg

Anti-Human CDH11 Antibody (SAA1820)

Sign In for Pricing
View Details
Anti-Human CDH11 Antibody (SAA1820)
HX212013-03 1 mg

Anti-Human CDH11 Antibody (SAA1820)

Sign In for Pricing
View Details
Integrin beta 1 (ITGB1) Human shRNA Plasmid Kit (Locus ID 3688)
TR320392 1 Kit

Integrin beta 1 (ITGB1) Human shRNA Plasmid Kit (Locus ID 3688)

Sign In for Pricing
View Details
Monkey TNF-α ELISPOT kit
CT133-PR2 2 Plates

Monkey TNF-α ELISPOT kit

Sign In for Pricing
View Details