Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Kukulcania hibernalis Omega-filistatoxin-Kh1a

Product Specifications

Product Name Alternative

Omega-FLTX-Kh1a; Toxin DW13.3

Abbreviation

Recombinant Kukulcania hibernalis Omega-filistatoxin-Kh1a protein

UniProt

P60979

Expression Region

1-74aa

Organism

Kukulcania hibernalis (Southern house spider) (Filistata hibernalis)

Target Sequence

AECLMIGDTSCVPRLGRRCCYGAWCYCDQQLSCRRVGRKRECGWVEVNCKCGWSWSQRIDDWRADYSCKCPEDQ

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Potently blocks vertebrate calcium channels Cav1 and Cav2. Is the most active on Cav2.2/CACNA1B (from HEK) (IC (50) =2.3 nM), followed by Cav2.1/CACNA1A (IC (50) =4.3 nM), Cav2.2/CACNA1B (from oocyte) (IC (50) =14.4 nM), Cav1.2/CACNA1C (IC (50) =26.8 nM), and Cav2.3/CACNA1E (IC (50) =96.4 nM) .

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Tyrosine-Protein Kinase Fer (FER) ELISA Kit
MBS9908561-01 48 Well

Porcine Tyrosine-Protein Kinase Fer (FER) ELISA Kit

Sign In for Pricing
View Details
Porcine Tyrosine-Protein Kinase Fer (FER) ELISA Kit
MBS9908561-02 96 Well

Porcine Tyrosine-Protein Kinase Fer (FER) ELISA Kit

Sign In for Pricing
View Details
Porcine Tyrosine-Protein Kinase Fer (FER) ELISA Kit
MBS9908561-03 5x 96 Well

Porcine Tyrosine-Protein Kinase Fer (FER) ELISA Kit

Sign In for Pricing
View Details
Porcine Tyrosine-Protein Kinase Fer (FER) ELISA Kit
MBS9908561-04 10x 96 Well

Porcine Tyrosine-Protein Kinase Fer (FER) ELISA Kit

Sign In for Pricing
View Details
Mouse anti-Cathepsin K ELISA Kit
ELA-E0429m 96 Tests

Mouse anti-Cathepsin K ELISA Kit

Sign In for Pricing
View Details
CHRAC1 Human
OM303234-01 5 µg

CHRAC1 Human

Sign In for Pricing
View Details