Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein E/APOE, Rabbit (His-B2M, Myc)

Apolipoprotein E/APOE is essential for lipid transport between organs and is a key component of lipoproteins such as chylomicrons and high-density lipoprotein. It binds to cell receptors such as LDLR and VLDLR to promote lipoprotein uptake, and has heparin-binding activity to interact with cell surface proteoglycans. Apolipoprotein E/APOE Protein, Rabbit (His-B2M, Myc) is the recombinant Rabbit-derived Apolipoprotein E/APOE protein, expressed by E. coli , with N-10*His, C-Myc, N-B2M labeled tag.

Product Specifications

Product Name Alternative

Apolipoprotein E/APOE Protein, Rabbit (His-B2M, Myc), Rabbit, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-e-apoe-protein-rabbit-his-b2m-myc.html

Purity

90.0

Smiles

TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKLQAAMPSKAPAAAPIENQ

Molecular Formula

100009337 (Gene_ID) P18287 (T20-Q311) (Accession)

Molecular Weight

Approximately 55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATF6 (437-449) Goat Polyclonal Antibody
AP32822PU-N 100 µg

ATF6 (437-449) Goat Polyclonal Antibody

Sign In for Pricing
View Details
3-Bromoaniline-d4
TRC-B679962-50MG 50 mg

3-Bromoaniline-d4

Sign In for Pricing
View Details
LIPM (NM_001128215) Human Over-expression Lysate
LY426929 100 µg

LIPM (NM_001128215) Human Over-expression Lysate

Sign In for Pricing
View Details
MLH1 (MutL Homolog 1) (MLH1/1324), CF740 conjugate, 0.1mg/mL
BNC741324-100 1x 100 µL

MLH1 (MutL Homolog 1) (MLH1/1324), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Orbital Shaker BSOR-105
BSOR-105 1 Unit

Orbital Shaker BSOR-105

Sign In for Pricing
View Details
BCL2 (NM_000633) Human Over-expression Lysate
LY424602 100 µg

BCL2 (NM_000633) Human Over-expression Lysate

Sign In for Pricing
View Details