Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein E/APOE, Rabbit (His-B2M, Myc)

Apolipoprotein E/APOE is essential for lipid transport between organs and is a key component of lipoproteins such as chylomicrons and high-density lipoprotein. It binds to cell receptors such as LDLR and VLDLR to promote lipoprotein uptake, and has heparin-binding activity to interact with cell surface proteoglycans. Apolipoprotein E/APOE Protein, Rabbit (His-B2M, Myc) is the recombinant Rabbit-derived Apolipoprotein E/APOE protein, expressed by E. coli , with N-10*His, C-Myc, N-B2M labeled tag.

Product Specifications

Product Name Alternative

Apolipoprotein E/APOE Protein, Rabbit (His-B2M, Myc), Rabbit, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-e-apoe-protein-rabbit-his-b2m-myc.html

Purity

90.0

Smiles

TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKLQAAMPSKAPAAAPIENQ

Molecular Formula

100009337 (Gene_ID) P18287 (T20-Q311) (Accession)

Molecular Weight

Approximately 55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD68 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI13H2]
TA802981AM 100 µL

CD68 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI13H2]

Sign In for Pricing
View Details
Human Selectin, Leukocyte (SELL) ELISA Kit
RD-SELL-Hu-01 96 Tests

Human Selectin, Leukocyte (SELL) ELISA Kit

Sign In for Pricing
View Details
Human Selectin, Leukocyte (SELL) ELISA Kit
RD-SELL-Hu-02 48 Tests

Human Selectin, Leukocyte (SELL) ELISA Kit

Sign In for Pricing
View Details
CDT2 (DTL) (Center) Rabbit Polyclonal Antibody
AP51328PU-N 400 µL

CDT2 (DTL) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS715523 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Siglecf Rat Monoclonal Antibody [Clone ID: 8D2]
AM26632FC-N 50 µg

Siglecf Rat Monoclonal Antibody [Clone ID: 8D2]

Sign In for Pricing
View Details