Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein E/APOE, Rabbit (His-B2M, Myc)

Apolipoprotein E/APOE is essential for lipid transport between organs and is a key component of lipoproteins such as chylomicrons and high-density lipoprotein. It binds to cell receptors such as LDLR and VLDLR to promote lipoprotein uptake, and has heparin-binding activity to interact with cell surface proteoglycans. Apolipoprotein E/APOE Protein, Rabbit (His-B2M, Myc) is the recombinant Rabbit-derived Apolipoprotein E/APOE protein, expressed by E. coli , with N-10*His, C-Myc, N-B2M labeled tag.

Product Specifications

Product Name Alternative

Apolipoprotein E/APOE Protein, Rabbit (His-B2M, Myc), Rabbit, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-e-apoe-protein-rabbit-his-b2m-myc.html

Purity

90.0

Smiles

TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKLQAAMPSKAPAAAPIENQ

Molecular Formula

100009337 (Gene_ID) P18287 (T20-Q311) (Accession)

Molecular Weight

Approximately 55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human APE1/APE Protein (His Tag)
PKSH030851 100 µg

Recombinant Human APE1/APE Protein (His Tag)

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/3171R), CF640R conjugate, 0.1mg/mL
BNC403171-100 1x 100 µL

CD3e (T-Cell Marker) (C3e/3171R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Behenic Acid Ethyl Ester (>90%)
TRC-B119585-25G 25 g

Behenic Acid Ethyl Ester (>90%)

Sign In for Pricing
View Details
Human MRPL50 activation kit by CRISPRa
GA110160 1 Kit

Human MRPL50 activation kit by CRISPRa

Sign In for Pricing
View Details
AP3S1 (NM_001284) Human Over-expression Lysate
LC420033 20 µg

AP3S1 (NM_001284) Human Over-expression Lysate

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Goat Polyclonal Antibody to Human Lambda (Free Bence Jones),
AA-2109-1 1 mL

Alkaline Phosphatase Conjugated Goat Polyclonal Antibody to Human Lambda (Free Bence Jones),

Sign In for Pricing
View Details