Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human coronavirus OC43 Nucleoprotein (N)

Product Specifications

Product Name Alternative

Nucleocapsid protein

Abbreviation

Recombinant Human coronavirus OC43 N protein

Gene Name

N

UniProt

P33469

Expression Region

1-448aa

Organism

Human coronavirus OC43 (HCoV-OC43)

Target Sequence

MSFTPGKQSSSRASSGNRSGNGILKWADQSDQVRNVQTRGRRAQPKQTATSQQPSGGNVVPYYSWFSGITQFQKGKEFEFVEGQGPPIAPGVPATEAKGYWYRHNRGSFKTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVYWVASNQADVNTPADIVDRDPSSDEAIPTRFPPGTVLPQGYYIEGSGRSAPNSRSTSRTSSRASSAGSRSRANSGNRTPTSGVTPDMADQIASLVLAKLGKDATKPQQVTKHTAKEVRQKILNKPRQKRSPNKQCTVQQCFGKRGPNQNFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLELAKVQNLSGNPDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNENLNAYQQQDGMMNMSPKPQRQRGHKNGQGENDNISVAVPKSRVQQNKSRELTAEDISLLKKMDEPYTEDTSEI

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein & Coronavirus Protein

Source

Mammalian cell

Field of Research

Microbiology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Lyophilized powder

Buffer

Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

54.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Membrin (GOSR2) Human Gene Knockout Kit (CRISPR)
KN402175 1 Kit

Membrin (GOSR2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RPL10L Rabbit Polyclonal Antibody
TA370331 100 µL

RPL10L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FA/VB9 (Folic Acid/Vitamin B9) ELISA Kit
E-EL-0009-01 24 Tests

FA/VB9 (Folic Acid/Vitamin B9) ELISA Kit

Sign In for Pricing
View Details
FA/VB9 (Folic Acid/Vitamin B9) ELISA Kit
E-EL-0009-02 48 Tests

FA/VB9 (Folic Acid/Vitamin B9) ELISA Kit

Sign In for Pricing
View Details
FA/VB9 (Folic Acid/Vitamin B9) ELISA Kit
E-EL-0009-03 96 Tests

FA/VB9 (Folic Acid/Vitamin B9) ELISA Kit

Sign In for Pricing
View Details
PLAP (Placental Alkaline Phosphatase) (PL8-F6), Biotin conjugate, 0.1mg/mL
BNCB0889-100 1x 100 µL

PLAP (Placental Alkaline Phosphatase) (PL8-F6), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details