Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-6R alpha, Mouse (HEK293, His)

IL-6R alpha is a subunit alpha of IL-6 receptors, also shared by other interleukin receptors. IL-6R alpha acts as IL-6 agonist and involves in JAK/STAT, MAPK, and Akt signaling pathway[1][2]. IL-6R alpha, Mouse consists of 460 amino acids (M1-R460) with two fibronectin type-III-like domains contained in the N-terminal part (109-214 a.a, 215-313 a.a) . Soluble IL-6R (sIL-6R) can be detected in the cerebrospinal fluid, conducts trans signaling by binding IL-6 and dimerized gp130, and exhibits a immune tissue expression property. IL-6R alpha Protein, Mouse (HEK293, His) is soluble form and produced in HEK293 cells with a C-Terminal His-tag.

Product Specifications

Product Name Alternative

IL-6R alpha Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-6r-alpha-protein-mouse-345a-a-hek293-his.html

Purity

95.0

Smiles

LVLGSCRALEVANGTVTSLPGATVTLICPGKEAAGNVTIHWVYSGSQNREWTTTGNTLVLRDVQLSDTGDYLCSLNDHLVGTVPLLVDVPPEEPKLSCFRKNPLVNAICEWRPSSTPSPTTKAVLFAKKINTTNGKSDFQVPCQYSQQLKSFSCQVEILEGDKVYHIVSLCVANSVGSKSSHNEAFHSLKMVQPDPPANLVVSAIPGRPRWLKVSWQHPETWDPSYYLLQFQLRYRPVWSKEFTVLLLPVAQYQCVIHDALRGVKHVVQVRGKEELDLGQWSEWSPEVTGTPWIAEPRTTPAGILWNPTQVSVEDSANHEDQYESSTEATSVLAPVQESSSMSLP

Molecular Formula

16194 (Gene_ID) P22272 (L20-P364) (Accession)

Molecular Weight

Approximately 50-65 kDa

References & Citations

[7]Mishra AK, et al. Metformin inhibits IL-6 signaling by decreasing IL-6R expression on multiple myeloma cells. Leukemia. 2019 Nov;33 (11) :2695-2709.|[8]Gruber CN, et al. Mapping Systemic Inflammation and Antibody Responses in Multisystem Inflammatory Syndrome in Children (MIS-C) . Cell. 2020 Nov 12;183 (4) :982-995.e14.|[9]Okazaki M, et al. Characterization of anti-mouse interleukin-6 receptor antibody. Immunol Lett. 2002 Dec 3;84 (3) :231-40.|[10]Hirota H, Kiyama H, Kishimoto T, Taga T. Accelerated Nerve Regeneration in Mice by upregulated expression of interleukin (IL) 6 and IL-6 receptor after trauma. J Exp Med. 1996 Jun 1;183 (6) :2627-34.|[11]Maione D, et al. Coexpression of IL-6 and soluble IL-6R causes nodular regenerative hyperplasia and adenomas of the liver. EMBO J. 1998 Oct 1;17 (19) :5588-97.|[1]Garbers C, et al. Inhibition of classic signaling is a novel function of soluble glycoprotein 130 (sgp130), which is controlled by the ratio of interleukin 6 and soluble interleukin 6 receptor. J Biol Chem. 2011 Dec 16;286 (50) :42959-70.|[2]Malemud, et al. Defective JAK-STAT Pathway Signaling Contributes to Autoimmune Diseases. Curr Pharmacol Rep 4, 358-366.|[3]Larsen JV, et al. SorLA in Interleukin-6 Signaling and Turnover. Mol Cell Biol. 2017 May 16;37 (11) :e00641-16.|[4]Kang S, et al. Targeting Interleukin-6 Signaling in Clinic. Immunity. 2019 Apr 16;50 (4) :1007-1023.|[5]Giannitrapani L, et al. Circulating IL-6 and sIL-6R in patients with hepatocellular carcinoma. Ann N Y Acad Sci. 2002 Jun;963:46-52.|[6]Arnold P, et al. Joint Reconstituted Signaling of the IL-6 Receptor via Extracellular Vesicles. Cells. 2020 May 24;9 (5) :1307.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRKACB CRISPRa sgRNA lentivector (set of three targets)(Rat)
37625126 3x 1.0µg DNA

PRKACB CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Camel Transmembrane Protein 14C (TMEM14C) ELISA Kit
MBS9928547-01 48 Well

Camel Transmembrane Protein 14C (TMEM14C) ELISA Kit

Sign In for Pricing
View Details
Camel Transmembrane Protein 14C (TMEM14C) ELISA Kit
MBS9928547-02 96 Well

Camel Transmembrane Protein 14C (TMEM14C) ELISA Kit

Sign In for Pricing
View Details
Camel Transmembrane Protein 14C (TMEM14C) ELISA Kit
MBS9928547-03 5x 96 Well

Camel Transmembrane Protein 14C (TMEM14C) ELISA Kit

Sign In for Pricing
View Details
Camel Transmembrane Protein 14C (TMEM14C) ELISA Kit
MBS9928547-04 10x 96 Well

Camel Transmembrane Protein 14C (TMEM14C) ELISA Kit

Sign In for Pricing
View Details
COPB1 3'UTR GFP Stable Cell Line
TU054821 1.0 mL

COPB1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details