IL-6R alpha, Mouse (HEK293, His)

IL-6R alpha is a subunit alpha of IL-6 receptors, also shared by other interleukin receptors. IL-6R alpha acts as IL-6 agonist and involves in JAK/STAT, MAPK, and Akt signaling pathway[1][2]. IL-6R alpha, Mouse consists of 460 amino acids (M1-R460) with two fibronectin type-III-like domains contained in the N-terminal part (109-214 a.a, 215-313 a.a) . Soluble IL-6R (sIL-6R) can be detected in the cerebrospinal fluid, conducts trans signaling by binding IL-6 and dimerized gp130, and exhibits a immune tissue expression property. IL-6R alpha Protein, Mouse (HEK293, His) is soluble form and produced in HEK293 cells with a C-Terminal His-tag.

Product Specifications

Product Name Alternative

IL-6R alpha Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-6r-alpha-protein-mouse-345a-a-hek293-his.html

Purity

95.0

Smiles

LVLGSCRALEVANGTVTSLPGATVTLICPGKEAAGNVTIHWVYSGSQNREWTTTGNTLVLRDVQLSDTGDYLCSLNDHLVGTVPLLVDVPPEEPKLSCFRKNPLVNAICEWRPSSTPSPTTKAVLFAKKINTTNGKSDFQVPCQYSQQLKSFSCQVEILEGDKVYHIVSLCVANSVGSKSSHNEAFHSLKMVQPDPPANLVVSAIPGRPRWLKVSWQHPETWDPSYYLLQFQLRYRPVWSKEFTVLLLPVAQYQCVIHDALRGVKHVVQVRGKEELDLGQWSEWSPEVTGTPWIAEPRTTPAGILWNPTQVSVEDSANHEDQYESSTEATSVLAPVQESSSMSLP

Molecular Formula

16194 (Gene_ID) P22272 (L20-P364) (Accession)

Molecular Weight

Approximately 50-65 kDa

References & Citations

[7]Mishra AK, et al. Metformin inhibits IL-6 signaling by decreasing IL-6R expression on multiple myeloma cells. Leukemia. 2019 Nov;33 (11) :2695-2709.|[8]Gruber CN, et al. Mapping Systemic Inflammation and Antibody Responses in Multisystem Inflammatory Syndrome in Children (MIS-C) . Cell. 2020 Nov 12;183 (4) :982-995.e14.|[9]Okazaki M, et al. Characterization of anti-mouse interleukin-6 receptor antibody. Immunol Lett. 2002 Dec 3;84 (3) :231-40.|[10]Hirota H, Kiyama H, Kishimoto T, Taga T. Accelerated Nerve Regeneration in Mice by upregulated expression of interleukin (IL) 6 and IL-6 receptor after trauma. J Exp Med. 1996 Jun 1;183 (6) :2627-34.|[11]Maione D, et al. Coexpression of IL-6 and soluble IL-6R causes nodular regenerative hyperplasia and adenomas of the liver. EMBO J. 1998 Oct 1;17 (19) :5588-97.|[1]Garbers C, et al. Inhibition of classic signaling is a novel function of soluble glycoprotein 130 (sgp130), which is controlled by the ratio of interleukin 6 and soluble interleukin 6 receptor. J Biol Chem. 2011 Dec 16;286 (50) :42959-70.|[2]Malemud, et al. Defective JAK-STAT Pathway Signaling Contributes to Autoimmune Diseases. Curr Pharmacol Rep 4, 358-366.|[3]Larsen JV, et al. SorLA in Interleukin-6 Signaling and Turnover. Mol Cell Biol. 2017 May 16;37 (11) :e00641-16.|[4]Kang S, et al. Targeting Interleukin-6 Signaling in Clinic. Immunity. 2019 Apr 16;50 (4) :1007-1023.|[5]Giannitrapani L, et al. Circulating IL-6 and sIL-6R in patients with hepatocellular carcinoma. Ann N Y Acad Sci. 2002 Jun;963:46-52.|[6]Arnold P, et al. Joint Reconstituted Signaling of the IL-6 Receptor via Extracellular Vesicles. Cells. 2020 May 24;9 (5) :1307.