Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-17A, Rat (CHO)

The IL-17A protein has important heterodimerization and homodimerization activities and is involved in a variety of processes, including responses to glucocorticoid stimulation and the regulation of cell death and transcription. IL-17A is present in the cytoplasm and extracellular space and has been implicated in diseases such as pancreatitis, inflammatory bowel disease, renal disease, and periodontal disease, and may serve as a biomarker. IL-17A Protein, Rat (CHO) is the recombinant rat-derived IL-17A protein, expressed by CHO , with tag free.

Product Specifications

Product Name Alternative

IL-17A Protein, Rat (CHO), Rat, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-17a-protein-rat-cho.html

Purity

95.00

Smiles

AVLIPQSSVCPNAEANNFLQNVKVNLKVLNSLSSKASSRRPSDYLNRSTSPWTLSRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS

Molecular Formula

301289 (Gene_ID) G3V7M4/NP_001100367 (A26-S158) (Accession)

Molecular Weight

Approximately 16-22 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human POTEH activation kit by CRISPRa
GA108502 1 Kit

Human POTEH activation kit by CRISPRa

Sign In for Pricing
View Details
TGFA Antibody
KC-3012-01 50 μL

TGFA Antibody

Sign In for Pricing
View Details
TGFA Antibody
KC-3012-02 100 µL

TGFA Antibody

Sign In for Pricing
View Details
TGFA Antibody
KC-3012-03 1 mL

TGFA Antibody

Sign In for Pricing
View Details
CD98 (SLC3A2) (NM_001012664) Human Recombinant Protein
TP316693M 100 µg

CD98 (SLC3A2) (NM_001012664) Human Recombinant Protein

Sign In for Pricing
View Details
1,8-Di-p-toluidinoanthraquinone
TRC-D494685-5G 5 g

1,8-Di-p-toluidinoanthraquinone

Sign In for Pricing
View Details