Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-17A, Rat (CHO)

The IL-17A protein has important heterodimerization and homodimerization activities and is involved in a variety of processes, including responses to glucocorticoid stimulation and the regulation of cell death and transcription. IL-17A is present in the cytoplasm and extracellular space and has been implicated in diseases such as pancreatitis, inflammatory bowel disease, renal disease, and periodontal disease, and may serve as a biomarker. IL-17A Protein, Rat (CHO) is the recombinant rat-derived IL-17A protein, expressed by CHO , with tag free.

Product Specifications

Product Name Alternative

IL-17A Protein, Rat (CHO), Rat, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-17a-protein-rat-cho.html

Purity

95.00

Smiles

AVLIPQSSVCPNAEANNFLQNVKVNLKVLNSLSSKASSRRPSDYLNRSTSPWTLSRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS

Molecular Formula

301289 (Gene_ID) G3V7M4/NP_001100367 (A26-S158) (Accession)

Molecular Weight

Approximately 16-22 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DRP1 Polyclonal Antibody
D-AB-10190L-01 25 µL

DRP1 Polyclonal Antibody

Sign In for Pricing
View Details
DRP1 Polyclonal Antibody
D-AB-10190L-02 100 µL

DRP1 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human DKK3 Protein (His Tag)
PKSH032354-01 10 µg

Recombinant Human DKK3 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human DKK3 Protein (His Tag)
PKSH032354-02 50 µg

Recombinant Human DKK3 Protein (His Tag)

Sign In for Pricing
View Details
Histone H3 Recombinant Rabbit monoclonal Antibody
HA750318 100 µL

Histone H3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CKMT2 (NM_001099736) Human Over-expression Lysate
LY420509 100 µg

CKMT2 (NM_001099736) Human Over-expression Lysate

Sign In for Pricing
View Details