Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-17A, Rat (CHO)

The IL-17A protein has important heterodimerization and homodimerization activities and is involved in a variety of processes, including responses to glucocorticoid stimulation and the regulation of cell death and transcription. IL-17A is present in the cytoplasm and extracellular space and has been implicated in diseases such as pancreatitis, inflammatory bowel disease, renal disease, and periodontal disease, and may serve as a biomarker. IL-17A Protein, Rat (CHO) is the recombinant rat-derived IL-17A protein, expressed by CHO , with tag free.

Product Specifications

Product Name Alternative

IL-17A Protein, Rat (CHO), Rat, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-17a-protein-rat-cho.html

Purity

95.00

Smiles

AVLIPQSSVCPNAEANNFLQNVKVNLKVLNSLSSKASSRRPSDYLNRSTSPWTLSRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS

Molecular Formula

301289 (Gene_ID) G3V7M4/NP_001100367 (A26-S158) (Accession)

Molecular Weight

Approximately 16-22 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Flufenoxuron-d3 (2,6-Difluorobenzoyl-d3)
TRC-F435101-2.5MG 2.5 mg

Flufenoxuron-d3 (2,6-Difluorobenzoyl-d3)

Sign In for Pricing
View Details
KLRG1 Human Gene Knockout Kit (CRISPR)
KN419705 1 Kit

KLRG1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N-Acetyl-L-glutamic Acid
TRC-A178255-10G 10 g

N-Acetyl-L-glutamic Acid

Sign In for Pricing
View Details
HDAC8 Mouse Monoclonal Antibody [Clone ID: OTI1A4]
CF809651 100 µg

HDAC8 Mouse Monoclonal Antibody [Clone ID: OTI1A4]

Sign In for Pricing
View Details
Glucose Regulated Protein 94 (GRP94) (9G10.F8.2), CF680 conjugate, 0.1mg/mL
BNC800940-100 1x 100 µL

Glucose Regulated Protein 94 (GRP94) (9G10.F8.2), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2467), CF647 conjugate, 0.1mg/mL
BNC472467-100 1x 100 µL

Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2467), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details