ICOS, Rhesus Macaque (HEK293, Fc)
ICOS proteins play a critical role in enhancing all basic T cell responses to foreign antigens. It promotes cell proliferation, lymphokine secretion and upregulation of intercellular interaction molecules, and promotes effective B cell antibody secretion. ICOS Protein, Rhesus macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived ICOS protein, expressed by HEK293 , with C-hFc labeled tag.
Product Specifications
Product Name Alternative
ICOS Protein, Rhesus Macaque (HEK293, Fc), Rhesus Macaque, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/icos-protein-rhesus-macaque-hek-293-fc.html
Smiles
GEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDRSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLK
Molecular Formula
705788 (Gene_ID) H9Z062 (G20-K140) (Accession)
Molecular Weight
Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL
CD106 / VCAM1 (1.4C3), CF488A conjugate, 0.1mg/mL
Insulin (E2-E3), CF640R conjugate, 0.1mg/mL
