Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFER, Human (His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (His) is the recombinant human-derived GFER protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-his.html

Purity

95.97

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 15.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL
BNC470008-500 1x 500 µL

MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZNF671 antibody
FNab09727 100 µg

ZNF671 antibody

Sign In for Pricing
View Details
Caspase-7 Recombinant Rabbit Monoclonal Antibody [JE59-36]
HA722317 100 µL

Caspase-7 Recombinant Rabbit Monoclonal Antibody [JE59-36]

Sign In for Pricing
View Details
Cyprodinil-13C6
TRC-C989061-5MG 5 mg

Cyprodinil-13C6

Sign In for Pricing
View Details
Rabbit IgG (H+L), AlpSdAbs® VHH
HA710052 100 µg

Rabbit IgG (H+L), AlpSdAbs® VHH

Sign In for Pricing
View Details
MAGEB4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3H2]
TA809147BM 100 µL

MAGEB4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3H2]

Sign In for Pricing
View Details