Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFER, Human (His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (His) is the recombinant human-derived GFER protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-his.html

Purity

95.97

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 15.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RFESD activation kit by CRISPRa
GA117315 1 Kit

Human RFESD activation kit by CRISPRa

Sign In for Pricing
View Details
Metaldehyde (Unspecified)
TRC-M225563-2.5G 2.5 g

Metaldehyde (Unspecified)

Sign In for Pricing
View Details
1-Hydroxypyrene beta-D-Glucuronide
TRC-H952750-5MG 5 mg

1-Hydroxypyrene beta-D-Glucuronide

Sign In for Pricing
View Details
Ptpn1 (NM_011201) Mouse Recombinant Protein
TP527012 20 µg

Ptpn1 (NM_011201) Mouse Recombinant Protein

Sign In for Pricing
View Details
Recombinant TACSTD2 Antibody
RC-7108-01 50 μL

Recombinant TACSTD2 Antibody

Sign In for Pricing
View Details
Recombinant TACSTD2 Antibody
RC-7108-02 100 µL

Recombinant TACSTD2 Antibody

Sign In for Pricing
View Details