Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFER, Human (His)

GFER protein, acting as an autocrine hepatotrophic growth factor, critically promotes liver regeneration. GFER Protein, Human (His) is the recombinant human-derived GFER protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GFER Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfer-protein-human-his.html

Purity

95.97

Smiles

MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Molecular Formula

2671 (Gene_ID) P55789-2 (M1-D125) (Accession)

Molecular Weight

Approximately 15.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTN Protein Vector (Human) (pPM-C-His)
PV114181 500 ng

PTN Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
STYK1 Protein Vector (Human) (pPB-N-His)
PV134079 500 ng

STYK1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Goat Interleukin 23 ELISA Kit
MBS032662 Inquire

Goat Interleukin 23 ELISA Kit

Sign In for Pricing
View Details
Porcine Interleukin 1, IL-1 ELISA KIT
E0109Po-01 48 Well

Porcine Interleukin 1, IL-1 ELISA KIT

Sign In for Pricing
View Details
Porcine Interleukin 1, IL-1 ELISA KIT
E0109Po-02 96 Well

Porcine Interleukin 1, IL-1 ELISA KIT

Sign In for Pricing
View Details
Porcine Interleukin 1, IL-1 ELISA KIT
E0109Po-03 5x 96 Tests

Porcine Interleukin 1, IL-1 ELISA KIT

Sign In for Pricing
View Details