Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PILR-beta, Mouse (HEK293, Fc)

The PILR-β protein is a paired immune system modulator and is considered a signal-activated receptor that associates with cell surface ITAM adapters such as DAP12. It interacts with CD99 and may help natural killer cells recognize target cells and activate dendritic cells. PILR-beta Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PILR-beta protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PILR-beta Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pilr-beta-protein-mouse-hek293-fc.html

Purity

91.50

Smiles

GNSERYNRKNGFGVNQPERCSGVQGGSIDIPFSFYFPWKLAKDPQMSIAWKWKDFHGEVIYNSSLPFIHEHFKGRLILNWTQGQTSGVLRILNLKESDQAQYFSRVNLQSTEGMKLWQSIPGTQLNVTQALNTTMRSPFIVTSEFTTAGLEHTSDQRNPSLMNLG

Molecular Formula

170741 (Gene_ID) Q2YFS2 (G29-G193) (Accession)

Molecular Weight

Approximately 50-70 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

3- (DIFLUOROMETHOXY) AZETIDINE
JH913307 1 Each

3- (DIFLUOROMETHOXY) AZETIDINE

Sign In for Pricing
View Details
Ccdc83 ORF Vector (Mouse) (pORF)
ORF040647 1.0 µg DNA

Ccdc83 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
CCDC8, CT (CCDC8, Coiled-coil domain-containing protein 8) (MaxLight 405)
MBS6281898-01 0.1 mL

CCDC8, CT (CCDC8, Coiled-coil domain-containing protein 8) (MaxLight 405)

Sign In for Pricing
View Details
CCDC8, CT (CCDC8, Coiled-coil domain-containing protein 8) (MaxLight 405)
MBS6281898-02 5x 0.1 mL

CCDC8, CT (CCDC8, Coiled-coil domain-containing protein 8) (MaxLight 405)

Sign In for Pricing
View Details
CEE Polyclonal Antibody, Cy3 Conjugated
bs-6405R-Cy3 100 µL

CEE Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
FAM130A1 (CSRNP2) (NM_030809) Human Over-expression Lysate
LS081566-20ug 20 µg

FAM130A1 (CSRNP2) (NM_030809) Human Over-expression Lysate

Sign In for Pricing
View Details