Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PILR-beta, Mouse (HEK293, Fc)

The PILR-β protein is a paired immune system modulator and is considered a signal-activated receptor that associates with cell surface ITAM adapters such as DAP12. It interacts with CD99 and may help natural killer cells recognize target cells and activate dendritic cells. PILR-beta Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PILR-beta protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PILR-beta Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pilr-beta-protein-mouse-hek293-fc.html

Purity

91.50

Smiles

GNSERYNRKNGFGVNQPERCSGVQGGSIDIPFSFYFPWKLAKDPQMSIAWKWKDFHGEVIYNSSLPFIHEHFKGRLILNWTQGQTSGVLRILNLKESDQAQYFSRVNLQSTEGMKLWQSIPGTQLNVTQALNTTMRSPFIVTSEFTTAGLEHTSDQRNPSLMNLG

Molecular Formula

170741 (Gene_ID) Q2YFS2 (G29-G193) (Accession)

Molecular Weight

Approximately 50-70 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ribonuclease Inhibitor (RNH1) (NM_203386) Human Recombinant Protein
TP318365M 100 µg

Ribonuclease Inhibitor (RNH1) (NM_203386) Human Recombinant Protein

Sign In for Pricing
View Details
TNFAIP8 (Tumor Necrosis Factor, alpha-Induced Protein 8, GG2-1, MDC-3.13, SCC-S2, SCCS2)
252814 50 µL

TNFAIP8 (Tumor Necrosis Factor, alpha-Induced Protein 8, GG2-1, MDC-3.13, SCC-S2, SCCS2)

Sign In for Pricing
View Details
Human TERT (Telomerase Reverse Transcriptase) ValidElisa Kit
EK340353 96 Well

Human TERT (Telomerase Reverse Transcriptase) ValidElisa Kit

Sign In for Pricing
View Details
SYTL2 (NM_032943) Human Tagged Lenti ORF Clone
RC217584L1 10 µg

SYTL2 (NM_032943) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Ralstonia solanacearum Lipid A export ATP-binding/permease protein MsbA (msbA)
MBS7020931-01 0.02 mg

Recombinant Ralstonia solanacearum Lipid A export ATP-binding/permease protein MsbA (msbA)

Sign In for Pricing
View Details
Recombinant Ralstonia solanacearum Lipid A export ATP-binding/permease protein MsbA (msbA)
MBS7020931-02 0.1 mg

Recombinant Ralstonia solanacearum Lipid A export ATP-binding/permease protein MsbA (msbA)

Sign In for Pricing
View Details