Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PILR-beta, Mouse (HEK293, Fc)

The PILR-β protein is a paired immune system modulator and is considered a signal-activated receptor that associates with cell surface ITAM adapters such as DAP12. It interacts with CD99 and may help natural killer cells recognize target cells and activate dendritic cells. PILR-beta Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PILR-beta protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PILR-beta Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pilr-beta-protein-mouse-hek293-fc.html

Purity

91.50

Smiles

GNSERYNRKNGFGVNQPERCSGVQGGSIDIPFSFYFPWKLAKDPQMSIAWKWKDFHGEVIYNSSLPFIHEHFKGRLILNWTQGQTSGVLRILNLKESDQAQYFSRVNLQSTEGMKLWQSIPGTQLNVTQALNTTMRSPFIVTSEFTTAGLEHTSDQRNPSLMNLG

Molecular Formula

170741 (Gene_ID) Q2YFS2 (G29-G193) (Accession)

Molecular Weight

Approximately 50-70 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Sox11 Pre-designed siRNA Set B
SI213538B 1 Each

Rat Sox11 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Human anti-Trypanosoma cruzi FP10 IgM
A11A82-FP10-M 1 Each

Human anti-Trypanosoma cruzi FP10 IgM

Sign In for Pricing
View Details
Lentiviral human ETV3L sgRNA gene knockout kit - Lentiviral human ETV3L sgRNA gene knockout kit (plasmid)
GTR15363131 1 Vial

Lentiviral human ETV3L sgRNA gene knockout kit - Lentiviral human ETV3L sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Ceacam20 Mouse siRNA Oligo Duplex (Locus ID 71601)
SR417652 1 Kit

Ceacam20 Mouse siRNA Oligo Duplex (Locus ID 71601)

Sign In for Pricing
View Details
Vesicle-Associated Membrane Protein 7 (VAMP7) Antibody
abx110538-01 20 µg

Vesicle-Associated Membrane Protein 7 (VAMP7) Antibody

Sign In for Pricing
View Details
Vesicle-Associated Membrane Protein 7 (VAMP7) Antibody
abx110538-02 50 µg

Vesicle-Associated Membrane Protein 7 (VAMP7) Antibody

Sign In for Pricing
View Details