Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PILR-beta, Mouse (HEK293, Fc)

The PILR-β protein is a paired immune system modulator and is considered a signal-activated receptor that associates with cell surface ITAM adapters such as DAP12. It interacts with CD99 and may help natural killer cells recognize target cells and activate dendritic cells. PILR-beta Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PILR-beta protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PILR-beta Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pilr-beta-protein-mouse-hek293-fc.html

Purity

91.50

Smiles

GNSERYNRKNGFGVNQPERCSGVQGGSIDIPFSFYFPWKLAKDPQMSIAWKWKDFHGEVIYNSSLPFIHEHFKGRLILNWTQGQTSGVLRILNLKESDQAQYFSRVNLQSTEGMKLWQSIPGTQLNVTQALNTTMRSPFIVTSEFTTAGLEHTSDQRNPSLMNLG

Molecular Formula

170741 (Gene_ID) Q2YFS2 (G29-G193) (Accession)

Molecular Weight

Approximately 50-70 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSF1R, Human (HEK293, His-Flag)
HY-P700511 1 Each

CSF1R, Human (HEK293, His-Flag)

Sign In for Pricing
View Details
Recombinant Mouse DDT
P4138-01 50 µg

Recombinant Mouse DDT

Sign In for Pricing
View Details
Recombinant Mouse DDT
P4138-02 200 µg

Recombinant Mouse DDT

Sign In for Pricing
View Details
Recombinant Mouse DDT
P4138-03 1 mg

Recombinant Mouse DDT

Sign In for Pricing
View Details
ULK2 (Unc-51-like Kinase 2, Serine/threonine-protein Kinase ULK2, KIAA0623) (AP) discontinued
135090-AP 100 µL

ULK2 (Unc-51-like Kinase 2, Serine/threonine-protein Kinase ULK2, KIAA0623) (AP) discontinued

Sign In for Pricing
View Details
Interferon alpha-1/13, active (IFNA1), Recombinant, Human
348079-01 100 µg

Interferon alpha-1/13, active (IFNA1), Recombinant, Human

Sign In for Pricing
View Details