Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PILR-beta, Mouse (HEK293, Fc)

The PILR-β protein is a paired immune system modulator and is considered a signal-activated receptor that associates with cell surface ITAM adapters such as DAP12. It interacts with CD99 and may help natural killer cells recognize target cells and activate dendritic cells. PILR-beta Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PILR-beta protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PILR-beta Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pilr-beta-protein-mouse-hek293-fc.html

Purity

91.50

Smiles

GNSERYNRKNGFGVNQPERCSGVQGGSIDIPFSFYFPWKLAKDPQMSIAWKWKDFHGEVIYNSSLPFIHEHFKGRLILNWTQGQTSGVLRILNLKESDQAQYFSRVNLQSTEGMKLWQSIPGTQLNVTQALNTTMRSPFIVTSEFTTAGLEHTSDQRNPSLMNLG

Molecular Formula

170741 (Gene_ID) Q2YFS2 (G29-G193) (Accession)

Molecular Weight

Approximately 50-70 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rbm8a (NM_001102407) Mouse Recombinant Protein
PM48611M5 20 µg

Rbm8a (NM_001102407) Mouse Recombinant Protein

Sign In for Pricing
View Details
Dkk-1 (Dickkopf 1, Dickkopf 1-like, Dickkopf Homolog 1, Dickkopf-related Protein 1, DKK 1, hDkk 1, SK) discontinued
D3810-02B 50 µg

Dkk-1 (Dickkopf 1, Dickkopf 1-like, Dickkopf Homolog 1, Dickkopf-related Protein 1, DKK 1, hDkk 1, SK) discontinued

Sign In for Pricing
View Details
Ctse Rat shRNA Plasmid (Locus ID 25424)
TL709548 1 Kit

Ctse Rat shRNA Plasmid (Locus ID 25424)

Sign In for Pricing
View Details
Ataxin 7 (ATXN7) (NM_000333) Human Tagged ORF Clone
RC224915 10 µg

Ataxin 7 (ATXN7) (NM_000333) Human Tagged ORF Clone

Sign In for Pricing
View Details
CaMKI gamma (CAMK1G) (NM_020439) Human Tagged ORF Clone Lentiviral Particle
RC207444L2V 200 µL

CaMKI gamma (CAMK1G) (NM_020439) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human PRPF19 shRNA Plasmid
abx959088-01 150 µg

Human PRPF19 shRNA Plasmid

Sign In for Pricing
View Details