Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PILR-beta, Mouse (HEK293, Fc)

The PILR-β protein is a paired immune system modulator and is considered a signal-activated receptor that associates with cell surface ITAM adapters such as DAP12. It interacts with CD99 and may help natural killer cells recognize target cells and activate dendritic cells. PILR-beta Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PILR-beta protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PILR-beta Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pilr-beta-protein-mouse-hek293-fc.html

Purity

91.50

Smiles

GNSERYNRKNGFGVNQPERCSGVQGGSIDIPFSFYFPWKLAKDPQMSIAWKWKDFHGEVIYNSSLPFIHEHFKGRLILNWTQGQTSGVLRILNLKESDQAQYFSRVNLQSTEGMKLWQSIPGTQLNVTQALNTTMRSPFIVTSEFTTAGLEHTSDQRNPSLMNLG

Molecular Formula

170741 (Gene_ID) Q2YFS2 (G29-G193) (Accession)

Molecular Weight

Approximately 50-70 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LentimiRa-hsa-miR-181c-5p Vector
mh41090 500 ng

LentimiRa-hsa-miR-181c-5p Vector

Sign In for Pricing
View Details
SNAP25
551771 100 µg

SNAP25

Sign In for Pricing
View Details
Cytochrome P450 2J2 Colorimetric Cell-Based ELISA Kit
MBS9500947-01 1 Kit

Cytochrome P450 2J2 Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
Cytochrome P450 2J2 Colorimetric Cell-Based ELISA Kit
MBS9500947-02 5x 1 Kit

Cytochrome P450 2J2 Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
ARHGEF1 (Rho Guanine Nucleotide Exchange Factor 1, 115kD Guanine Nucleotide Exchange Factor, Sub1.5, p115-RhoGEF, p115RhoGEF) (MaxLight 650)
123500-ML650 100 µL

ARHGEF1 (Rho Guanine Nucleotide Exchange Factor 1, 115kD Guanine Nucleotide Exchange Factor, Sub1.5, p115-RhoGEF, p115RhoGEF) (MaxLight 650)

Sign In for Pricing
View Details
GALK2 (NM_001289031) Human Tagged ORF Clone
RG238208 10 µg

GALK2 (NM_001289031) Human Tagged ORF Clone

Sign In for Pricing
View Details