Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PILR-beta, Mouse (HEK293, Fc)

The PILR-β protein is a paired immune system modulator and is considered a signal-activated receptor that associates with cell surface ITAM adapters such as DAP12. It interacts with CD99 and may help natural killer cells recognize target cells and activate dendritic cells. PILR-beta Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PILR-beta protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PILR-beta Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pilr-beta-protein-mouse-hek293-fc.html

Purity

91.50

Smiles

GNSERYNRKNGFGVNQPERCSGVQGGSIDIPFSFYFPWKLAKDPQMSIAWKWKDFHGEVIYNSSLPFIHEHFKGRLILNWTQGQTSGVLRILNLKESDQAQYFSRVNLQSTEGMKLWQSIPGTQLNVTQALNTTMRSPFIVTSEFTTAGLEHTSDQRNPSLMNLG

Molecular Formula

170741 (Gene_ID) Q2YFS2 (G29-G193) (Accession)

Molecular Weight

Approximately 50-70 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL
BNC470391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF594 conjugate, 0.1mg/mL
BNC940152-500 1x 500 µL

CD11c (HC1/1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF640R conjugate, 0.1mg/mL
BNC400861-100 1x 100 µL

HSP27 (G3.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF647 conjugate, 0.1mg/mL
BNC470449-100 1x 100 µL

CD104 (UM-A9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL
BNC680304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF405S conjugate, 0.1mg/mL
BNC040645-100 1x 100 µL

FOXP3 (3G3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details