Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PILR-beta, Mouse (HEK293, Fc)

The PILR-β protein is a paired immune system modulator and is considered a signal-activated receptor that associates with cell surface ITAM adapters such as DAP12. It interacts with CD99 and may help natural killer cells recognize target cells and activate dendritic cells. PILR-beta Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PILR-beta protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PILR-beta Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pilr-beta-protein-mouse-hek293-fc.html

Purity

91.50

Smiles

GNSERYNRKNGFGVNQPERCSGVQGGSIDIPFSFYFPWKLAKDPQMSIAWKWKDFHGEVIYNSSLPFIHEHFKGRLILNWTQGQTSGVLRILNLKESDQAQYFSRVNLQSTEGMKLWQSIPGTQLNVTQALNTTMRSPFIVTSEFTTAGLEHTSDQRNPSLMNLG

Molecular Formula

170741 (Gene_ID) Q2YFS2 (G29-G193) (Accession)

Molecular Weight

Approximately 50-70 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP7B Antibody
E38PA4574 100 µL

ATP7B Antibody

Sign In for Pricing
View Details
1-Iodo-3,3,3-trifluoropropane
409877-01 500 mg

1-Iodo-3,3,3-trifluoropropane

Sign In for Pricing
View Details
1-Iodo-3,3,3-trifluoropropane
409877-02 1 g

1-Iodo-3,3,3-trifluoropropane

Sign In for Pricing
View Details
PARD3B (Partitioning Defective 3 Homolog B, Amyotrophic Lateral Sclerosis 2 Chromosomal Region Candidate Gene 19 Protein, PAR3-beta, Partitioning Defective 3-like Protein, PAR3-L Protein, ALS2CR19, PAR3B, PAR3L, MGC16131) (Biotin)
130875-Biotin 100 µL

PARD3B (Partitioning Defective 3 Homolog B, Amyotrophic Lateral Sclerosis 2 Chromosomal Region Candidate Gene 19 Protein, PAR3-beta, Partitioning Defective 3-like Protein, PAR3-L Protein, ALS2CR19, PAR3B, PAR3L, MGC16131) (Biotin)

Sign In for Pricing
View Details
TRAF6 Antibody
OAAJ06629-100UL 100 µL

TRAF6 Antibody

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Probable 26S proteasome regulatory subunit rpn7 (rpn7)
MBS1424081-01 0.02 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Probable 26S proteasome regulatory subunit rpn7 (rpn7)

Sign In for Pricing
View Details