Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PILR-beta, Mouse (HEK293, Fc)

The PILR-β protein is a paired immune system modulator and is considered a signal-activated receptor that associates with cell surface ITAM adapters such as DAP12. It interacts with CD99 and may help natural killer cells recognize target cells and activate dendritic cells. PILR-beta Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PILR-beta protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PILR-beta Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pilr-beta-protein-mouse-hek293-fc.html

Purity

91.50

Smiles

GNSERYNRKNGFGVNQPERCSGVQGGSIDIPFSFYFPWKLAKDPQMSIAWKWKDFHGEVIYNSSLPFIHEHFKGRLILNWTQGQTSGVLRILNLKESDQAQYFSRVNLQSTEGMKLWQSIPGTQLNVTQALNTTMRSPFIVTSEFTTAGLEHTSDQRNPSLMNLG

Molecular Formula

170741 (Gene_ID) Q2YFS2 (G29-G193) (Accession)

Molecular Weight

Approximately 50-70 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rotavirus Ag Rapid Test
HSGIA2200A1RV 20 Tests/Kit

Rotavirus Ag Rapid Test

Sign In for Pricing
View Details
Lentiviral human HECTD1 sgRNA gene knockout kit - Lentiviral human HECTD1 sgRNA gene knockout kit (plasmid)
GTR15395723 1 Vial

Lentiviral human HECTD1 sgRNA gene knockout kit - Lentiviral human HECTD1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
KCNN3 Protein Vector (Human) (pPM-C-HA)
PV022219 500 ng

KCNN3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
TRNAP10 AAV Vector (Human) (CMV)
48251101 1 µg

TRNAP10 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
PUS10 Protein Vector (Rat) (pPM-C-His)
PV297441 500 ng

PUS10 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Olfr169 (NM_001011855) Mouse Tagged ORF Clone Lentiviral Particle
MR213729L4V 200 µL

Olfr169 (NM_001011855) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details