Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PILR-beta, Mouse (HEK293, Fc)

The PILR-β protein is a paired immune system modulator and is considered a signal-activated receptor that associates with cell surface ITAM adapters such as DAP12. It interacts with CD99 and may help natural killer cells recognize target cells and activate dendritic cells. PILR-beta Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PILR-beta protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PILR-beta Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pilr-beta-protein-mouse-hek293-fc.html

Purity

91.50

Smiles

GNSERYNRKNGFGVNQPERCSGVQGGSIDIPFSFYFPWKLAKDPQMSIAWKWKDFHGEVIYNSSLPFIHEHFKGRLILNWTQGQTSGVLRILNLKESDQAQYFSRVNLQSTEGMKLWQSIPGTQLNVTQALNTTMRSPFIVTSEFTTAGLEHTSDQRNPSLMNLG

Molecular Formula

170741 (Gene_ID) Q2YFS2 (G29-G193) (Accession)

Molecular Weight

Approximately 50-70 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C17orf59, ID (C17orf59, Uncharacterized protein C17orf59) (MaxLight 650) discontinued
032764-ML650 100 µL

C17orf59, ID (C17orf59, Uncharacterized protein C17orf59) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Block, PCR plate 96 x 0.2ml, skirted or non-skirted For 1-block dry bath only
BSWPCR1 1 PC

Block, PCR plate 96 x 0.2ml, skirted or non-skirted For 1-block dry bath only

Sign In for Pricing
View Details
TRPC4AP Rabbit Polyclonal Antibody
TA350547 100 µL

TRPC4AP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MIR5684 Recombinant Protein (Human)
RP074646 100 µg

MIR5684 Recombinant Protein (Human)

Sign In for Pricing
View Details
Fluor Violet 450-Goat Anti-Rat IgG (H+L)
MBS2579236-01 0.12 mL

Fluor Violet 450-Goat Anti-Rat IgG (H+L)

Sign In for Pricing
View Details
Fluor Violet 450-Goat Anti-Rat IgG (H+L)
MBS2579236-02 0.5 mL

Fluor Violet 450-Goat Anti-Rat IgG (H+L)

Sign In for Pricing
View Details