Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PILR-beta, Mouse (HEK293, Fc)

The PILR-β protein is a paired immune system modulator and is considered a signal-activated receptor that associates with cell surface ITAM adapters such as DAP12. It interacts with CD99 and may help natural killer cells recognize target cells and activate dendritic cells. PILR-beta Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PILR-beta protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PILR-beta Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pilr-beta-protein-mouse-hek293-fc.html

Purity

91.50

Smiles

GNSERYNRKNGFGVNQPERCSGVQGGSIDIPFSFYFPWKLAKDPQMSIAWKWKDFHGEVIYNSSLPFIHEHFKGRLILNWTQGQTSGVLRILNLKESDQAQYFSRVNLQSTEGMKLWQSIPGTQLNVTQALNTTMRSPFIVTSEFTTAGLEHTSDQRNPSLMNLG

Molecular Formula

170741 (Gene_ID) Q2YFS2 (G29-G193) (Accession)

Molecular Weight

Approximately 50-70 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUMA1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV712938 1.0 µg DNA

NUMA1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Mouse Cdk5r1 ELISA Kit
EF014582 96 Tests

Mouse Cdk5r1 ELISA Kit

Sign In for Pricing
View Details
ZHX2 AAV siRNA Pooled Vector
51243161 1.0 µg

ZHX2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Anti-Tau Reference Antibody (semorinemab)
MBS9247166-01 0.1 mg

Anti-Tau Reference Antibody (semorinemab)

Sign In for Pricing
View Details
Anti-Tau Reference Antibody (semorinemab)
MBS9247166-02 5x 0.1 mg

Anti-Tau Reference Antibody (semorinemab)

Sign In for Pricing
View Details
Monkey Glucosidase Beta, Acid (GbA) ELISA Kit
abx360010 96 Well

Monkey Glucosidase Beta, Acid (GbA) ELISA Kit

Sign In for Pricing
View Details