Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PILR-beta, Mouse (HEK293, Fc)

The PILR-β protein is a paired immune system modulator and is considered a signal-activated receptor that associates with cell surface ITAM adapters such as DAP12. It interacts with CD99 and may help natural killer cells recognize target cells and activate dendritic cells. PILR-beta Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PILR-beta protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PILR-beta Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pilr-beta-protein-mouse-hek293-fc.html

Purity

91.50

Smiles

GNSERYNRKNGFGVNQPERCSGVQGGSIDIPFSFYFPWKLAKDPQMSIAWKWKDFHGEVIYNSSLPFIHEHFKGRLILNWTQGQTSGVLRILNLKESDQAQYFSRVNLQSTEGMKLWQSIPGTQLNVTQALNTTMRSPFIVTSEFTTAGLEHTSDQRNPSLMNLG

Molecular Formula

170741 (Gene_ID) Q2YFS2 (G29-G193) (Accession)

Molecular Weight

Approximately 50-70 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-EGFR (Epidermal Growth Factor Receptor) Monoclonal Antibody (Clone: GFR/1667)
36-2202-100 100 µg

Anti-EGFR (Epidermal Growth Factor Receptor) Monoclonal Antibody (Clone: GFR/1667)

Sign In for Pricing
View Details
Recombinant Mycobacterium Avium bioB Protein(aa 1-345)
VAng-Yyj1160-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Avium bioB Protein(aa 1-345)

Sign In for Pricing
View Details
Rabbit anti-Drosophila melanogaster (Fruit fly) hfw Polyclonal Antibody
MBS9014279 Inquire

Rabbit anti-Drosophila melanogaster (Fruit fly) hfw Polyclonal Antibody

Sign In for Pricing
View Details
Cd302 3'UTR Luciferase Stable Cell Line
TU201969 1.0 mL

Cd302 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human Growth Differentiation Factor 5 (GDF5) Antibody Pair Kit (with Standard)
MBS2101315-01 5x 96 Tests

Human Growth Differentiation Factor 5 (GDF5) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Growth Differentiation Factor 5 (GDF5) Antibody Pair Kit (with Standard)
MBS2101315-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Growth Differentiation Factor 5 (GDF5) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details