Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PILR-beta, Mouse (HEK293, Fc)

The PILR-β protein is a paired immune system modulator and is considered a signal-activated receptor that associates with cell surface ITAM adapters such as DAP12. It interacts with CD99 and may help natural killer cells recognize target cells and activate dendritic cells. PILR-beta Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PILR-beta protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PILR-beta Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pilr-beta-protein-mouse-hek293-fc.html

Purity

91.50

Smiles

GNSERYNRKNGFGVNQPERCSGVQGGSIDIPFSFYFPWKLAKDPQMSIAWKWKDFHGEVIYNSSLPFIHEHFKGRLILNWTQGQTSGVLRILNLKESDQAQYFSRVNLQSTEGMKLWQSIPGTQLNVTQALNTTMRSPFIVTSEFTTAGLEHTSDQRNPSLMNLG

Molecular Formula

170741 (Gene_ID) Q2YFS2 (G29-G193) (Accession)

Molecular Weight

Approximately 50-70 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

THUMP domain-containing protein 1 (THUMPD1) Human ELISA Kit
H5950 96 Tests

THUMP domain-containing protein 1 (THUMPD1) Human ELISA Kit

Sign In for Pricing
View Details
Anti-Human BMP1 Antibody (SAA1793)
HY077013-01 50 µg

Anti-Human BMP1 Antibody (SAA1793)

Sign In for Pricing
View Details
Anti-Human BMP1 Antibody (SAA1793)
HY077013-02 100 µg

Anti-Human BMP1 Antibody (SAA1793)

Sign In for Pricing
View Details
Anti-Human BMP1 Antibody (SAA1793)
HY077013-03 1 mg

Anti-Human BMP1 Antibody (SAA1793)

Sign In for Pricing
View Details
CACNB2 (NM_201596) Human Tagged ORF Clone Lentiviral Particle
RC211493L2V 200 µL

CACNB2 (NM_201596) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Zswim9 Mouse Gene Knockout Kit (CRISPR)
KN500486 1 Kit

Zswim9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details