Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PILR-beta, Mouse (HEK293, Fc)

The PILR-β protein is a paired immune system modulator and is considered a signal-activated receptor that associates with cell surface ITAM adapters such as DAP12. It interacts with CD99 and may help natural killer cells recognize target cells and activate dendritic cells. PILR-beta Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PILR-beta protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PILR-beta Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pilr-beta-protein-mouse-hek293-fc.html

Purity

91.50

Smiles

GNSERYNRKNGFGVNQPERCSGVQGGSIDIPFSFYFPWKLAKDPQMSIAWKWKDFHGEVIYNSSLPFIHEHFKGRLILNWTQGQTSGVLRILNLKESDQAQYFSRVNLQSTEGMKLWQSIPGTQLNVTQALNTTMRSPFIVTSEFTTAGLEHTSDQRNPSLMNLG

Molecular Formula

170741 (Gene_ID) Q2YFS2 (G29-G193) (Accession)

Molecular Weight

Approximately 50-70 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DTTP (100 mM) ≥99% HPLC
C01580-1 1 mL (1.0 mL/Vial)

DTTP (100 mM) ≥99% HPLC

Sign In for Pricing
View Details
HLA-DRA Antibody
MBS8501377-01 0.1 mL

HLA-DRA Antibody

Sign In for Pricing
View Details
HLA-DRA Antibody
MBS8501377-02 0.1 mL (AF405L)

HLA-DRA Antibody

Sign In for Pricing
View Details
HLA-DRA Antibody
MBS8501377-03 0.1 mL (AF405S)

HLA-DRA Antibody

Sign In for Pricing
View Details
HLA-DRA Antibody
MBS8501377-04 0.1 mL (AF610)

HLA-DRA Antibody

Sign In for Pricing
View Details
HLA-DRA Antibody
MBS8501377-05 0.1 mL (AF635)

HLA-DRA Antibody

Sign In for Pricing
View Details