Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PILR-beta, Mouse (HEK293, Fc)

The PILR-β protein is a paired immune system modulator and is considered a signal-activated receptor that associates with cell surface ITAM adapters such as DAP12. It interacts with CD99 and may help natural killer cells recognize target cells and activate dendritic cells. PILR-beta Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PILR-beta protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PILR-beta Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pilr-beta-protein-mouse-hek293-fc.html

Purity

91.50

Smiles

GNSERYNRKNGFGVNQPERCSGVQGGSIDIPFSFYFPWKLAKDPQMSIAWKWKDFHGEVIYNSSLPFIHEHFKGRLILNWTQGQTSGVLRILNLKESDQAQYFSRVNLQSTEGMKLWQSIPGTQLNVTQALNTTMRSPFIVTSEFTTAGLEHTSDQRNPSLMNLG

Molecular Formula

170741 (Gene_ID) Q2YFS2 (G29-G193) (Accession)

Molecular Weight

Approximately 50-70 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SorCS1 (E-8) PE
sc-365605 PE 200 µg/mL

SorCS1 (E-8) PE

Sign In for Pricing
View Details
Gm1322 HDR Plasmid (m)
sc-436415-HDR 20 µg

Gm1322 HDR Plasmid (m)

Sign In for Pricing
View Details
GFP hsa-miR-92b-3p AAV miRNA Vector
Amh1102600 500 ng

GFP hsa-miR-92b-3p AAV miRNA Vector

Sign In for Pricing
View Details
Cpd Rat shRNA Lentiviral Particle (Locus ID 25306)
TL709453V 500 µL Each

Cpd Rat shRNA Lentiviral Particle (Locus ID 25306)

Sign In for Pricing
View Details
C10orf27 Polyclonal Antibody, RBITC Conjugated
bs-9720R-RBITC 100 µL

C10orf27 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal Perilipin-3/TIP47 Antibody [FITC]
NB110-40764F 0.1 mL

Rabbit Polyclonal Perilipin-3/TIP47 Antibody [FITC]

Sign In for Pricing
View Details