Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PILR-beta, Mouse (HEK293, Fc)

The PILR-β protein is a paired immune system modulator and is considered a signal-activated receptor that associates with cell surface ITAM adapters such as DAP12. It interacts with CD99 and may help natural killer cells recognize target cells and activate dendritic cells. PILR-beta Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PILR-beta protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PILR-beta Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pilr-beta-protein-mouse-hek293-fc.html

Purity

91.50

Smiles

GNSERYNRKNGFGVNQPERCSGVQGGSIDIPFSFYFPWKLAKDPQMSIAWKWKDFHGEVIYNSSLPFIHEHFKGRLILNWTQGQTSGVLRILNLKESDQAQYFSRVNLQSTEGMKLWQSIPGTQLNVTQALNTTMRSPFIVTSEFTTAGLEHTSDQRNPSLMNLG

Molecular Formula

170741 (Gene_ID) Q2YFS2 (G29-G193) (Accession)

Molecular Weight

Approximately 50-70 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMUG1 (NM_001243791) Human Tagged ORF Clone
RC231979 10 µg

SMUG1 (NM_001243791) Human Tagged ORF Clone

Sign In for Pricing
View Details
SIX2, ID (SIX2, Homeobox protein SIX2, Sine oculis homeobox homolog 2) (Biotin)
MBS6347859-01 0.2 mL

SIX2, ID (SIX2, Homeobox protein SIX2, Sine oculis homeobox homolog 2) (Biotin)

Sign In for Pricing
View Details
SIX2, ID (SIX2, Homeobox protein SIX2, Sine oculis homeobox homolog 2) (Biotin)
MBS6347859-02 5x 0.2 mL

SIX2, ID (SIX2, Homeobox protein SIX2, Sine oculis homeobox homolog 2) (Biotin)

Sign In for Pricing
View Details
Wd Repeat Domain 4 (WDR4) Antibody
abx116658 100 µL

Wd Repeat Domain 4 (WDR4) Antibody

Sign In for Pricing
View Details
C11orf48 (LBHD1) (NM_024099) Human 3' UTR Clone
SC204681 10 µg

C11orf48 (LBHD1) (NM_024099) Human 3' UTR Clone

Sign In for Pricing
View Details
Anti-Human TNFSF15/TL1A Antibody (3B3)
HF526023-01 50 µg

Anti-Human TNFSF15/TL1A Antibody (3B3)

Sign In for Pricing
View Details