Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PILR-beta, Mouse (HEK293, Fc)

The PILR-β protein is a paired immune system modulator and is considered a signal-activated receptor that associates with cell surface ITAM adapters such as DAP12. It interacts with CD99 and may help natural killer cells recognize target cells and activate dendritic cells. PILR-beta Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PILR-beta protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PILR-beta Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pilr-beta-protein-mouse-hek293-fc.html

Purity

91.50

Smiles

GNSERYNRKNGFGVNQPERCSGVQGGSIDIPFSFYFPWKLAKDPQMSIAWKWKDFHGEVIYNSSLPFIHEHFKGRLILNWTQGQTSGVLRILNLKESDQAQYFSRVNLQSTEGMKLWQSIPGTQLNVTQALNTTMRSPFIVTSEFTTAGLEHTSDQRNPSLMNLG

Molecular Formula

170741 (Gene_ID) Q2YFS2 (G29-G193) (Accession)

Molecular Weight

Approximately 50-70 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

8-[ (6-Amino) hexyl]-amino-adenosine-2′,5′-bisphosphate – DYQ-661
JBS-NU-812-661Q 40 µL

8-[ (6-Amino) hexyl]-amino-adenosine-2′,5′-bisphosphate – DYQ-661

Sign In for Pricing
View Details
Bovine ANGPT4/Angiopoietin-4 ELISA Kit
E0023Bo 96 Tests

Bovine ANGPT4/Angiopoietin-4 ELISA Kit

Sign In for Pricing
View Details
SPRR1A (HRP)
577715-01 50 µg

SPRR1A (HRP)

Sign In for Pricing
View Details
SPRR1A (HRP)
577715-02 100 µg

SPRR1A (HRP)

Sign In for Pricing
View Details
MVP Mouse Monoclonal Antibody [Clone ID: 1011]
AM32034PU-N 100 µg

MVP Mouse Monoclonal Antibody [Clone ID: 1011]

Sign In for Pricing
View Details
Nucleosome Antigen
MBS319890-01 1 mg

Nucleosome Antigen

Sign In for Pricing
View Details