Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PILR-beta, Mouse (HEK293, Fc)

The PILR-β protein is a paired immune system modulator and is considered a signal-activated receptor that associates with cell surface ITAM adapters such as DAP12. It interacts with CD99 and may help natural killer cells recognize target cells and activate dendritic cells. PILR-beta Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PILR-beta protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PILR-beta Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pilr-beta-protein-mouse-hek293-fc.html

Purity

91.50

Smiles

GNSERYNRKNGFGVNQPERCSGVQGGSIDIPFSFYFPWKLAKDPQMSIAWKWKDFHGEVIYNSSLPFIHEHFKGRLILNWTQGQTSGVLRILNLKESDQAQYFSRVNLQSTEGMKLWQSIPGTQLNVTQALNTTMRSPFIVTSEFTTAGLEHTSDQRNPSLMNLG

Molecular Formula

170741 (Gene_ID) Q2YFS2 (G29-G193) (Accession)

Molecular Weight

Approximately 50-70 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNNC1 Antibody (HRP)
E30AH2679 100 µL

TNNC1 Antibody (HRP)

Sign In for Pricing
View Details
Gpr12 ORF Vector (Rat) (pORF)
ORF067763 1.0 µg DNA

Gpr12 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
MIRacle™ mmu-miR-367-5p miRNA Agomir/Antagomir
AM3522 2 OD, 4 OD, 50 OD

MIRacle™ mmu-miR-367-5p miRNA Agomir/Antagomir

Sign In for Pricing
View Details
Lentiviral human DENND4B sgRNA gene knockout kit - Lentiviral human DENND4B sgRNA gene knockout kit (25)
GTR15359724 1 Vial

Lentiviral human DENND4B sgRNA gene knockout kit - Lentiviral human DENND4B sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Aldh1a3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4332407 1.0 µg DNA

Aldh1a3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
VTCN1 (V-Set Domain Containing T-Cell Activation Inhibitor 1, B7H4, B7-H4, B7S1, B7x, BC032925, Immune Costimulatory Protein B7H4)
339635-01 50 µL

VTCN1 (V-Set Domain Containing T-Cell Activation Inhibitor 1, B7H4, B7-H4, B7S1, B7x, BC032925, Immune Costimulatory Protein B7H4)

Sign In for Pricing
View Details