Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PILR-beta, Mouse (HEK293, Fc)

The PILR-β protein is a paired immune system modulator and is considered a signal-activated receptor that associates with cell surface ITAM adapters such as DAP12. It interacts with CD99 and may help natural killer cells recognize target cells and activate dendritic cells. PILR-beta Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PILR-beta protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PILR-beta Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pilr-beta-protein-mouse-hek293-fc.html

Purity

91.50

Smiles

GNSERYNRKNGFGVNQPERCSGVQGGSIDIPFSFYFPWKLAKDPQMSIAWKWKDFHGEVIYNSSLPFIHEHFKGRLILNWTQGQTSGVLRILNLKESDQAQYFSRVNLQSTEGMKLWQSIPGTQLNVTQALNTTMRSPFIVTSEFTTAGLEHTSDQRNPSLMNLG

Molecular Formula

170741 (Gene_ID) Q2YFS2 (G29-G193) (Accession)

Molecular Weight

Approximately 50-70 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-JNK1/2/3 (T183+T183+T221) Recombinant Antibody, PE Conjugated
bsm-52462R-PE-01 20 µL

Phospho-JNK1/2/3 (T183+T183+T221) Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
Phospho-JNK1/2/3 (T183+T183+T221) Recombinant Antibody, PE Conjugated
bsm-52462R-PE-02 100 µL

Phospho-JNK1/2/3 (T183+T183+T221) Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
TBPL1 Protein Vector (Human) (pPM-C-HA)
46293021 500 ng

TBPL1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
DNAJC13 3'UTR GFP Stable Cell Line
TU056154 1.0 mL

DNAJC13 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Polyclonal GPCR6 / GPR101 Antibody (Cytoplasmic Domain)
APR16466G 0.05mg

Polyclonal GPCR6 / GPR101 Antibody (Cytoplasmic Domain)

Sign In for Pricing
View Details
Mouse Monoclonal SF3B4 Antibody (3A1) [Alexa Fluor 532]
NBP1-92692AF532 0.1 mL

Mouse Monoclonal SF3B4 Antibody (3A1) [Alexa Fluor 532]

Sign In for Pricing
View Details