Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PILR-beta, Mouse (HEK293, Fc)

The PILR-β protein is a paired immune system modulator and is considered a signal-activated receptor that associates with cell surface ITAM adapters such as DAP12. It interacts with CD99 and may help natural killer cells recognize target cells and activate dendritic cells. PILR-beta Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PILR-beta protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PILR-beta Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pilr-beta-protein-mouse-hek293-fc.html

Purity

91.50

Smiles

GNSERYNRKNGFGVNQPERCSGVQGGSIDIPFSFYFPWKLAKDPQMSIAWKWKDFHGEVIYNSSLPFIHEHFKGRLILNWTQGQTSGVLRILNLKESDQAQYFSRVNLQSTEGMKLWQSIPGTQLNVTQALNTTMRSPFIVTSEFTTAGLEHTSDQRNPSLMNLG

Molecular Formula

170741 (Gene_ID) Q2YFS2 (G29-G193) (Accession)

Molecular Weight

Approximately 50-70 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP6V0D2 (V-type Proton ATPase Subunit D 2, V-ATPase Subunit D 2, Vacuolar Proton Pump Subunit D 2) (FITC)
MBS6146041-01 0.1 mL

ATP6V0D2 (V-type Proton ATPase Subunit D 2, V-ATPase Subunit D 2, Vacuolar Proton Pump Subunit D 2) (FITC)

Sign In for Pricing
View Details
ATP6V0D2 (V-type Proton ATPase Subunit D 2, V-ATPase Subunit D 2, Vacuolar Proton Pump Subunit D 2) (FITC)
MBS6146041-02 5x 0.1 mL

ATP6V0D2 (V-type Proton ATPase Subunit D 2, V-ATPase Subunit D 2, Vacuolar Proton Pump Subunit D 2) (FITC)

Sign In for Pricing
View Details
Polyclonal Antibody to Cre
MBS668607-01 0.05 mL

Polyclonal Antibody to Cre

Sign In for Pricing
View Details
Polyclonal Antibody to Cre
MBS668607-02 5x 0.05 mL

Polyclonal Antibody to Cre

Sign In for Pricing
View Details
CCDC109B Antibody
E38QA6961 100 µL

CCDC109B Antibody

Sign In for Pricing
View Details
CDK2AP1 (H-4) Alexa Fluor® 647
sc-390283 AF647 200 µg/mL

CDK2AP1 (H-4) Alexa Fluor® 647

Sign In for Pricing
View Details