Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PILR-beta, Mouse (HEK293, Fc)

The PILR-β protein is a paired immune system modulator and is considered a signal-activated receptor that associates with cell surface ITAM adapters such as DAP12. It interacts with CD99 and may help natural killer cells recognize target cells and activate dendritic cells. PILR-beta Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PILR-beta protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

PILR-beta Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pilr-beta-protein-mouse-hek293-fc.html

Purity

91.50

Smiles

GNSERYNRKNGFGVNQPERCSGVQGGSIDIPFSFYFPWKLAKDPQMSIAWKWKDFHGEVIYNSSLPFIHEHFKGRLILNWTQGQTSGVLRILNLKESDQAQYFSRVNLQSTEGMKLWQSIPGTQLNVTQALNTTMRSPFIVTSEFTTAGLEHTSDQRNPSLMNLG

Molecular Formula

170741 (Gene_ID) Q2YFS2 (G29-G193) (Accession)

Molecular Weight

Approximately 50-70 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CXCL8/IL-8 Antibody (6217) [HRP]
FAB208H 0.1 mL

Mouse Monoclonal CXCL8/IL-8 Antibody (6217) [HRP]

Sign In for Pricing
View Details
Rabbit Polyclonal PKLR Antibody [Alexa Fluor 647]
NBP2-97071AF647 0.1 mL

Rabbit Polyclonal PKLR Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
ELOVL4 polyclonal antibody
BS72337-01 50 µL

ELOVL4 polyclonal antibody

Sign In for Pricing
View Details
ELOVL4 polyclonal antibody
BS72337-02 100 µL

ELOVL4 polyclonal antibody

Sign In for Pricing
View Details
C11orf83 Protein Vector (Human) (pPB-N-His)
PV065430 500 ng

C11orf83 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Eotaxin 3 (MaxLight 490) discontinued
E3352-01-ML490 100 µL

Eotaxin 3 (MaxLight 490) discontinued

Sign In for Pricing
View Details