CD3 delta, Cynomolgus (HEK293, Fc)
Selected Variant
HY-P70091
Size: 1 Each
CD3 δ protein is a component of the TCR-CD3 complex on T lymphocytes and plays a crucial role in adaptive immunity. Activated by APC, TCR signals through the CD3 chain, including CD3D, CD3E, CD3G, and CD3Z. CD3 delta Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived CD3 delta protein, expressed by HEK293 , with C-hFc labeled tag.
Product Specifications
Product Name Alternative
CD3 delta Protein, Cynomolgus (HEK293, Fc), Cynomolgus, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd3-delta-protein-cynomolgus-hek-293-fc.html
Smiles
FKIPVEELEDRVFVKCNTSVTWVEGTVGTLLTNNTRLDLGKRILDPRGIYRCNGTDIYKDKESAVQVHYRMCQNCVELDPATLA
Molecular Formula
102133701 (Gene_ID) Q95LI8 (F22-A105) (Accession)
Molecular Weight
Approximately 50-65 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Price
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Tenascin (T2H5), CF405S conjugate, 0.1mg/mL
Mitochondrial Marker (AE-1), CF405S conjugate, 0.1mg/mL
Von Willebrand Factor (3E2D10 + VWF635), CF405S conjugate, 0.1mg/mL
Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (rIGHG4/1345), CF647 conjugate, 0.1mg/mL
![Human IL-3 Mouse Monoclonal Antibody [PSH0-98] - BSA and Azide free (Detector)](https://cdn.genprice.uk/products/992/68dd1c8b061270361ea81634/imageurl/ha601155.webp)
Human IL-3 Mouse Monoclonal Antibody [PSH0-98] - BSA and Azide free (Detector)
