Cardiotrophin-1/CTF1, Human (His)
Cardiotrophin-1/CTF1 Protein, Human (His) is an approximately 25.0 kDa human cardiotrophin-1 protein with a His-flag. Cardiotrophin-1belongs to the IL-6 family and can act as a cytoprotective molecule[1].
Product Specifications
Product Name Alternative
Cardiotrophin-1/CTF1 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cardiotrophin-1-ctf1-protein-human-his.html
Smiles
HHHHHHMSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA
Molecular Formula
1489 (Gene_ID) Q16619-1 (M1-A201) (Accession)
Molecular Weight
Approximately 25 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]O Robledo, et al. Signaling of the cardiotrophin-1 receptor. Evidence for a third receptor component. J Biol Chem. 1997 Feb 21;272 (8) :4855-63.|[2]D Pennica, et al. Cardiotrophin-1: a multifunctional cytokine that signals via LIF receptor-gp 130 dependent pathways. Cytokine Growth Factor Rev. 1996 Jun;7 (1) :81-91.|[3]Miguel López-Yoldi, et al. Cardiotrophin-1: A multifaceted cytokine. Cytokine Growth Factor Rev. 2015 Oct;26 (5) :523-32.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC742146-500 1x 500 µL
PU.1 (SPI-1) (B-Cell Marker) (PU1/2146), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401841-100 1x 100 µL
Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (rOV-TL12/30), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400142-100 1x 100 µL
Beta-2 Microglobulin (B2M) (BBM.1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681778-500 1x 500 µL
Spectrin beta III (SPTBN2) (SPTBN2/1778), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041797-500 1x 500 µL
Histone H1 (Nuclear Marker) (r1415-1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details