Cardiotrophin-1/CTF1, Human (His)
Cardiotrophin-1/CTF1 Protein, Human (His) is an approximately 25.0 kDa human cardiotrophin-1 protein with a His-flag. Cardiotrophin-1belongs to the IL-6 family and can act as a cytoprotective molecule[1].
Product Specifications
Product Name Alternative
Cardiotrophin-1/CTF1 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cardiotrophin-1-ctf1-protein-human-his.html
Smiles
HHHHHHMSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA
Molecular Formula
1489 (Gene_ID) Q16619-1 (M1-A201) (Accession)
Molecular Weight
Approximately 25 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]O Robledo, et al. Signaling of the cardiotrophin-1 receptor. Evidence for a third receptor component. J Biol Chem. 1997 Feb 21;272 (8) :4855-63.|[2]D Pennica, et al. Cardiotrophin-1: a multifunctional cytokine that signals via LIF receptor-gp 130 dependent pathways. Cytokine Growth Factor Rev. 1996 Jun;7 (1) :81-91.|[3]Miguel López-Yoldi, et al. Cardiotrophin-1: A multifaceted cytokine. Cytokine Growth Factor Rev. 2015 Oct;26 (5) :523-32.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Rabbit Polyclonal YIPF4 Antibody [FITC]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
419235-01 50 mg
2,2-Bis- (4-hydroxyphenyl) hexafluoropropane Monosulfate
Sign In for Pricing
View Details 419235-02 100 mg
2,2-Bis- (4-hydroxyphenyl) hexafluoropropane Monosulfate
Sign In for Pricing
View Details 
bs-16706R-BF350 100 µL
IRGC Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
Sign In for Pricing
View Details