Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RSPO3/R-spondin-3, Human (HEK293, His)

RSPO3 is a potent activator of the canonical Wnt pathway and can bind to LGR4-6 receptors to initiate a complex with phosphorylated LRP6 and Frizzled receptors. This interaction activates the canonical Wnt pathway and upregulates target genes. R-spondin 3 Protein, Human (HEK293, His) is the recombinant human-derived R-spondin 3 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

RSPO3/R-spondin-3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/r-spondin-3-protein-human-125aa-hek293-his.html

Purity

98.0

Smiles

QNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIV

Molecular Formula

84870 (Gene_ID) Q9BXY4-1 (Q22-V146) (Accession)

Molecular Weight

Approximately 15-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZFHX2 activation kit by CRISPRa
GA113888 1 Kit

Human ZFHX2 activation kit by CRISPRa

Sign In for Pricing
View Details
ALKBH5 Recombinant Rabbit monoclonal Antibody
HA750692 100 µL

ALKBH5 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
ADB-5'Br-INACA
TRC-A433430-500MG 500 mg

ADB-5'Br-INACA

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR562189 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
Histone H3 (mono methyl K4) Recombinant Rabbit monoclonal Antibody
HA751136 100 µL

Histone H3 (mono methyl K4) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Dnmt2 Recombinant Rabbit Monoclonal Antibody [PSH03-43]
HA721988 100 µL

Dnmt2 Recombinant Rabbit Monoclonal Antibody [PSH03-43]

Sign In for Pricing
View Details