Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free beta-NGF, Mouse (His)

Nerve Growth Factor-β (Beta-NGF; NGF) is a neurotrophic factor that regulates neuronal survival and differentiation. NGF is also a seminal plasma protein involved in ovulation and luteinizing. NGF has potential functions in the female reproductive system to help overcome the current problem of early embryo loss[1][2][3]. Animal-Free Beta-NGF Protein, Mouse (His) is produced by E.coli, with C-terminal His-tag.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free Beta-NGF Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-beta-ngf-protein-mouse-his.html

Purity

98.0

Smiles

MSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG

Molecular Formula

18049 (Gene_ID) P01139 (S122-G241) (Accession)

Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Castellanos MR, et al. Obtención y caracterización del beta-NGF murino. Aplicación en un modelo de envejecimiento cerebral [Obtention and characterization of murine beta-NGF. Application in a model of cerebral aging]. Rev Neurol. 1998;26 (153) :717-722.|[2]Lipov EG, et al. Possible Reversal of PTSD-Related DNA Methylation by Sympathetic Blockade. J Mol Neurosci. 2017 May;62 (1) :67-72.|[3]Lima FS, et al. Insights into nerve growth factor-β role in bovine reproduction - Review. Theriogenology. 2020 Jul 1;150:288-293.|[4]Yada M, et al. NGF stimulates differentiation of osteoblastic MC3T3-E1 cells. Biochem Biophys Res Commun. 1994 Dec 15;205 (2) :1187-93.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kcnh7 (NM_133207) Mouse Tagged ORF Clone
MR217120 10 µg

Kcnh7 (NM_133207) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-4H5), CF488A conjugate, 0.1mg/mL
BNC880431-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-4H5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GPM6B ORF Vector (Human) (pORF)
ORF004586 1.0 µg DNA

GPM6B ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Mouse Early Growth Response Protein 1 ELISA Kit
IMSEGR1KT 1 Each

Mouse Early Growth Response Protein 1 ELISA Kit

Sign In for Pricing
View Details
Human LRG1 Knockout A549 cell line
GTR15414456 1 Vial

Human LRG1 Knockout A549 cell line

Sign In for Pricing
View Details
2- Chloro- 2'- deoxyadenosine (Cladribine, 2-Cl-dAdo, CdA)
C 028-100 100 µmol ~ 29 mg

2- Chloro- 2'- deoxyadenosine (Cladribine, 2-Cl-dAdo, CdA)

Sign In for Pricing
View Details