Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSPAN31, Human (HEK293, Fc)

TSPAN31 is a member of the tetraspanin protein family, which has four hydrophobic domains. TSPAN31 mediates signal transduction events and plays a role in the regulation of cell development, activation, growth, and movement. TSPAN31 is also associated with tumorigenesis and osteosarcoma. TSPAN31 Protein, Human (HEK293, Fc) is the recombinant human-derived TSPAN31 protein, expressed by HEK293 , with N-mFc labeled tag.

Product Specifications

Product Name Alternative

TSPAN31 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tspan31-protein-human-hek293-fc.html

Purity

98.0

Smiles

CSCLAINRSKQTDVINASWWVMSNKTRDELERSFDCCGLFNLTTLYQQDYDFCTAICKSQSPTCQMCGEKFLKHSDEALK

Molecular Formula

6302 (Gene_ID) Q12999 (C94-K173) (Accession)

Molecular Weight

Approximately 43-55 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycobacterium Avium pup Protein (aa 1-64)
VAng-Yyj2720-500gEcoli 500 µg (E. coli)

Recombinant Mycobacterium Avium pup Protein (aa 1-64)

Sign In for Pricing
View Details
PMP22 Recombinant Antibody, PE-Cy5 Conjugated
bsm-54072R-PE-Cy5 100 µL

PMP22 Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
SLC44A3 siRNA (Rat)
MBS8220718-01 15 nmol

SLC44A3 siRNA (Rat)

Sign In for Pricing
View Details
SLC44A3 siRNA (Rat)
MBS8220718-02 30 nmol

SLC44A3 siRNA (Rat)

Sign In for Pricing
View Details
SLC44A3 siRNA (Rat)
MBS8220718-03 5x 30 nmol

SLC44A3 siRNA (Rat)

Sign In for Pricing
View Details
ATP5J2 (G42) polyclonal antibody
BS3496-01 50 µL

ATP5J2 (G42) polyclonal antibody

Sign In for Pricing
View Details