Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 3 (FGF3)

Product Specifications

Product Name Alternative

(FGF-3) (Heparin-binding growth factor 3) (HBGF-3) (Proto-oncogene Int-2)

Abbreviation

Recombinant Human FGF3 protein

Gene Name

FGF3

UniProt

P11487

Expression Region

18-239aa

Organism

Homo sapiens (Human)

Target Sequence

AAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHPSGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVERIHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPSHVQASRLGSQLEASAH

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

This enzyme is an effector of chloramphenicol resistance in bacteria.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

32.4 kDa

References & Citations

"Nucleotide sequence of a chloramphenicol acetyl transferase gene from Clostridium difficile." Wren B.W., Mullany P., Clayton C., Tabaqchali S. Nucleic Acids Res. 17:4877-4877 (1989)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Mouse Monoclonal Antibody
AMM82050-01 1 Each

CD44 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CD44 Mouse Monoclonal Antibody
AMM82050-02 50 µL

CD44 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CD44 Mouse Monoclonal Antibody
AMM82050-03 100 µL

CD44 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Magic™ Membrane Protein Human SLC2A8 (Solute carrier family 2 member 8) Full Length
MPC0818K Each

Magic™ Membrane Protein Human SLC2A8 (Solute carrier family 2 member 8) Full Length

Sign In for Pricing
View Details
TFPI-2 CRISPR Activation Plasmid (m2)
sc-423362-ACT-2 20 µg

TFPI-2 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
SNAI2 Mouse mAb
E2220410 100 µL

SNAI2 Mouse mAb

Sign In for Pricing
View Details