Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ribonuclease K6 (RNASE6)

Product Specifications

Product Name Alternative

(RNase K6)

Abbreviation

Recombinant Human RNASE6 protein

Gene Name

RNASE6

UniProt

Q93091

Expression Region

24-150aa

Organism

Homo sapiens (Human)

Target Sequence

WPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPVHLDSIL

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Ribonuclease which shows a preference for the pyrimidines uridine and cytosine. Has potent antibacterial activity against a range of Gram-positive and Gram-negative bacteria, including P.aeruginosa, A.baumanii, M.luteus, S.aureus, E.faecalis, E.faecium, S.saprophyticus and E.coli. Causes loss of bacterial membrane integrity, and also promotes agglutination of Gram-negative bacteria. Probably contributes to urinary tract sterility. Bactericidal activity is independent of RNase activity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.7 kDa

References & Citations

"Ribonucleases 6 and 7 have antimicrobial function in the human and murine urinary tract." Becknell B., Eichler T.E., Beceiro S., Li B., Easterling R.S., Carpenter A.R., James C.L., McHugh K.M., Hains D.S., Partida-Sanchez S., Spencer J.D. Kidney Int. 87:151-161 (2015)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Leifsonia xyli subsp. xyli Octanoyltransferase (lipB)
MBS1415917-01 0.02 mg (E-Coli)

Recombinant Leifsonia xyli subsp. xyli Octanoyltransferase (lipB)

Sign In for Pricing
View Details
Recombinant Leifsonia xyli subsp. xyli Octanoyltransferase (lipB)
MBS1415917-02 0.1 mg (E-Coli)

Recombinant Leifsonia xyli subsp. xyli Octanoyltransferase (lipB)

Sign In for Pricing
View Details
Recombinant Leifsonia xyli subsp. xyli Octanoyltransferase (lipB)
MBS1415917-03 0.02 mg (Yeast)

Recombinant Leifsonia xyli subsp. xyli Octanoyltransferase (lipB)

Sign In for Pricing
View Details
Recombinant Leifsonia xyli subsp. xyli Octanoyltransferase (lipB)
MBS1415917-04 0.1 mg (Yeast)

Recombinant Leifsonia xyli subsp. xyli Octanoyltransferase (lipB)

Sign In for Pricing
View Details
Recombinant Leifsonia xyli subsp. xyli Octanoyltransferase (lipB)
MBS1415917-05 0.02 mg (Baculovirus)

Recombinant Leifsonia xyli subsp. xyli Octanoyltransferase (lipB)

Sign In for Pricing
View Details
Recombinant Leifsonia xyli subsp. xyli Octanoyltransferase (lipB)
MBS1415917-06 0.02 mg (Mammalian-Cell)

Recombinant Leifsonia xyli subsp. xyli Octanoyltransferase (lipB)

Sign In for Pricing
View Details