Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IMPA2, Human (His)

IMPA2, or Inositol monophosphatase 2, demonstrates enzymatic activity by utilizing various substrates such as myo-inositol monophosphates, scylloinositol 1,4-diphosphate, glucose-1-phosphate, beta-glycerophosphate, and 2'-AMP. Additionally, it has been implicated as the pharmacological target for the action of lithium ions (Li⁺) in the brain. IMPA2 Protein, Human (His) is the recombinant human-derived IMPA2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IMPA2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/impa2-protein-human-his.html

Purity

98.0

Smiles

MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYGRDDEK

Molecular Formula

3613 (Gene_ID) O14732-1 (M1-K288) (Accession)

Molecular Weight

Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EFTUD2 (NM_004247) Human Over-expression Lysate
E45H07113-2 20 µg

EFTUD2 (NM_004247) Human Over-expression Lysate

Sign In for Pricing
View Details
Glutathione Reductase/GSR Rabbit Polyclonal Antibody (Cy3)
orb2612478 100 µg

Glutathione Reductase/GSR Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Monkey CNTF (Ciliary Neurotrophic Factor) ELISA Kit
MBS2509100-01 24 Tests

Monkey CNTF (Ciliary Neurotrophic Factor) ELISA Kit

Sign In for Pricing
View Details
Monkey CNTF (Ciliary Neurotrophic Factor) ELISA Kit
MBS2509100-02 48 Tests

Monkey CNTF (Ciliary Neurotrophic Factor) ELISA Kit

Sign In for Pricing
View Details
Monkey CNTF (Ciliary Neurotrophic Factor) ELISA Kit
MBS2509100-03 96 Tests

Monkey CNTF (Ciliary Neurotrophic Factor) ELISA Kit

Sign In for Pricing
View Details
Monkey CNTF (Ciliary Neurotrophic Factor) ELISA Kit
MBS2509100-04 5x 96 Tests

Monkey CNTF (Ciliary Neurotrophic Factor) ELISA Kit

Sign In for Pricing
View Details